KEGG   Bifidobacterium longum NCC2705: BL1631
Entry
BL1631            CDS       T00094                                 

Symbol
glcP
Name
(GenBank) D-Glucose-proton symporter
Organism
blo  Bifidobacterium longum NCC2705
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12 OATP
Other DBs
NCBI-ProteinID: AAN25419
UniProt: Q8G3X1
Position
complement(2038882..2040435)
AA seq 517 aa
MTTTTASPVSKQTASAAQETSATGAAATAIETIETGVAGVAGAATNAAANAIEDLEAAES
HGFSTRFPLNSAFIFTFGALGGMLFGFDTGIISGASPLIESDFGLSVSQTGFITSSVLIG
SCAGALSIGALSDRFGRKKLLIVSALLFLLGSGLCASSTGFAMMVCARIILGLAVGAASA
LTPAYLAELAPKERRGSLSTLFQLMVTFGILLAYASNLGFLNHNLFGIRDWRWMLGSALV
PAALLLLGGLLLPESPRYLVNKGDTRNAFKVLTLIRKDVDQTQVQIELDEIKAVAAQDTK
GGVRELFRIARPALVAAIGIMLFQQLVGINSVIYFLPQVFIKGFGFPEGDAIWVSVGIGV
VNFVSTIVATLIMDRFPRKGMLIFGSIVMTVSLAVLAVMNFVGDVAVLAVPTMILIAFYI
LGFAVSWGPIAWVLIGEIFPLSVRGIGSSFGSAANWLGNFIVSQFFLVLLDAFGNNVGGP
FAIFGVFSALSIPFVLRLVPETKGKSLEEIEKEMTKR
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgacgacgacaacggcatcacccgtatcgaaacagacggcatccgcggcgcaggaaacc
agcgcaaccggtgcggcggccaccgcaatcgaaaccatcgaaaccggcgtggccggagtg
gcgggcgcggccacaaacgcggcagccaacgcaatcgaggacctcgaagccgccgaatcg
cacggcttctccacgcgcttcccgctcaacagcgcattcatcttcaccttcggcgcgctc
ggcggcatgctgttcggtttcgacaccggcatcatctccggcgcctccccgcttatcgaa
tcggacttcggcctgagcgtctctcagaccggcttcatcacctcctcggtgctgatcggc
tcgtgcgcaggcgcgctgtcgatcggcgcactgtctgaccggttcggccgcaagaagctg
ctcatcgtctccgcgctgctgttcctgctcggctcaggcctgtgcgcctcctccaccgga
ttcgcgatgatggtgtgcgcccgcatcatcctgggtctcgccgtcggcgcggcctccgcc
ctgaccccggcgtacttggccgaactggcgccgaaggagcgtcgcggctcactgtccacg
ctgttccagctcatggtcaccttcggcattctgctggcctacgcctccaacctcggattc
ctgaaccacaacctcttcggcatccgcgactggcgctggatgctcggttcggcgctggtg
ccggccgccttgttgctgctcggcggcctgttgctgcccgaatccccgcgttatctggtg
aacaagggcgacacccgcaacgccttcaaagtgcttacgctgattcgcaaggacgtggat
cagacccaggtgcagattgagctggacgaaatcaaggccgtggccgcacaggacaccaag
ggtggtgtgcgcgaactgttccgtatcgctcgtccggcgctggtggccgccatcggtatc
atgctgttccagcagctcgtgggcatcaactcggtgatctacttcctgccgcaggtgttc
atcaagggcttcggcttccctgaaggcgacgcgatctgggtgtcggtgggcatcggcgtg
gtgaacttcgtgagcaccatcgtggccacgcttatcatggatcgtttcccgcgcaagggc
atgctgatcttcggttccatcgtgatgaccgtttcgctcgcggtgctcgccgtgatgaac
ttcgtgggcgacgtggccgtgctggcagtgccgacgatgattctcatcgctttctatatc
ctcggctttgcggtctcgtggggcccgatcgcctgggtgcttatcggcgagatcttcccg
ctgagcgtgcgcggcatcggctcatccttcggctcggcggcgaactggctgggcaacttc
atcgtctcccagttcttcctcgtgctgctcgatgcgttcggcaacaatgtgggcggcccg
ttcgcgattttcggcgtgttctcggccctgtccatcccgttcgtgctgcgcttggtgccc
gagaccaagggcaagtcgctggaggaaatcgagaaggaaatgaccaagcgctag

DBGET integrated database retrieval system