KEGG   Bifidobacterium longum NCC2705: BL1761Help
Entry
BL1761            CDS       T00094                                 

Definition
(RefSeq) beta-1,3-exoglucanase
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00500  Starch and sucrose metabolism
blo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BL1761
Enzymes [BR:blo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     BL1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase
Motif
Other DBs
NCBI-GeneID: 1022031
NCBI-ProteinID: NP_696908
UniProt: Q8G3J8
Position
2192640..2193854
Genome map
AA seq 404 aa AA seqDB search
MTGMASGALGVGERINGVNLGNWLVLERWMKPGIFAASGEADEIWLHRATKSAELEALLT
RHRDTYITEADFRNIAAHGCNLVRIPVPYFVFGDVPGHPGCTEYLDRAFDSAERAGLKIL
IDLHTVPGSQNGFDNGGLTGVVRWHRSPRAVAYALDVLVRLARRYRDHAALFGIEVLNEP
IDWLTYAMSPSSRQAKDRSEARGSGPIPMAFLKRFYRETYHRLRPILAGNQVIVFHDGFR
LGRWRDWFVREGMRGVMLDTHVYLVMAEQFPLFRLIPDRWLMGWYRLFVRWNERRIRRAA
RYTPVIVGEWCVANGLVNRVVDKRTGDGGRSKENAMHSASIRGSIYREIAAMQRKAWNVS
AGQIYWSYQLRGNRDFLPTIDPQSDTSRLDPWDFTHVWHAGWMV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgacaggtatggcatcgggcgcgctgggtgttggcgaacgaattaatggggtgaacctc
ggcaattggctggtgctggagcggtggatgaagccggggatttttgccgccagcggcgag
gcggacgagatctggctgcatcgggctacgaagtcggctgagctggaggctttgctgacg
cggcatcgcgacacgtatattaccgaggccgatttccggaacattgccgcacatggctgc
aatctggtgcgtattccagtgccgtatttcgtgttcggggatgtgcccggtcacccgggc
tgtaccgagtatctggacagagcgttcgactcggccgagcgggccgggctcaagattctt
atcgacctgcacacggtgcccggctcgcagaacggattcgataacggcggcctcaccggc
gtggtgcgctggcatcgtagcccgcgagcggtcgcctatgcgctggatgtgctggtccgt
ctggctcgccggtatcgcgaccacgcggcgctgttcggtatcgaagtgctgaatgagccg
attgactggctgacgtatgccatgtcaccatcgagcaggcaggcgaaagaccggtccgaa
gcgcgaggaagcgggcctattccgatggcgttcctcaagcgtttctaccgcgagacatac
caccggttgcgcccgattctggcagggaatcaagtcatcgtgttccatgacggcttccga
ctgggccgttggcgggactggttcgtgcgcgagggcatgcggggcgtcatgctcgatacg
catgtctatctggtcatggccgagcaattcccgctgttccgtctgatcccggatcggtgg
ctgatgggctggtatcgcttgttcgtgcgctggaacgaacgccgcatccgccgggccgcg
cgctatacgccggtgattgtaggggagtggtgcgtggctaatggtctggtaaatcgggtg
gtcgataagcgtacaggcgatggtggccgctccaaggaaaacgccatgcacagtgcatct
atcagaggctctatttaccgcgagatcgccgccatgcaacgcaaggcatggaacgtgtcc
gccgggcaaatctattggagctaccaattacgtggtaatcgtgatttcttgcctaccatc
gacccgcaatccgacacgtcacgcctcgacccttgggatttcactcacgtctggcacgct
ggttggatggtgtaa

DBGET integrated database retrieval system