KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_0569Help
Entry
BLIJ_0569         CDS       T02092                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
blon00010  Glycolysis / Gluconeogenesis
blon00052  Galactose metabolism
blon00500  Starch and sucrose metabolism
blon00520  Amino sugar and nucleotide sugar metabolism
blon00521  Streptomycin biosynthesis
blon01100  Metabolic pathways
blon01110  Biosynthesis of secondary metabolites
blon01120  Microbial metabolism in diverse environments
blon01130  Biosynthesis of antibiotics
blon01200  Carbon metabolism
Module
blon_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLIJ_0569
   00052 Galactose metabolism
    BLIJ_0569
   00500 Starch and sucrose metabolism
    BLIJ_0569
   00520 Amino sugar and nucleotide sugar metabolism
    BLIJ_0569
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BLIJ_0569
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BLIJ_0569
Enzymes [BR:blon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BLIJ_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Pan_kinase BcrAD_BadFG FtsA FGGY_N
Motif
Other DBs
NCBI-ProteinID: BAJ68162
Position
641812..642762
Genome map
AA seq 316 aa AA seqDB search
MTTLAIDIGGTKIAAAVCDANDSIIQRWRVPTPMDADAINTHIAEIYREAVAAGHTDIEA
IGISAAGNVSADRKTLTFSANIPAWINYNLSEHVGALIDHAVPIVVENDANCAGWGEFVH
GAGQGSSNMVALTVGTGLGGAIVINGQLYRGSFGMAAELGHLPMVPDGDHCGCGLRGCAE
RYTSGTSLENFAKSAVRRRPQDAKRLLELCGGDITKLEGPMVSQAAQEGDVLGLYAFGKI
GEWLGRTMAAVSAVLDPDLFVIGGGVVAVGDILLEPARYNYQRFLEGSAYRGHAKIVAAV
AGQDAGLIGAANLALR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctcgccattgatatcggcggaaccaagatcgccgctgccgtctgcgatgca
aacgacagcatcatccagcgttggcgcgtccccacgccgatggacgccgacgccatcaac
acgcatatcgccgagatctaccgcgaagccgtcgccgctggccacaccgatatcgaggcc
atcggcatctccgcggccggtaatgtgagcgcggatcgcaagacgctcaccttctccgcc
aacattccggcctggatcaattacaatctgtccgagcatgtcggcgcgttgatcgaccat
gccgttccgatcgtcgtcgagaacgatgccaactgcgccggctggggcgaattcgtgcac
ggtgccggccaaggcagctccaacatggtcgcgctgaccgtgggcaccggcctcggtggc
gccatcgtgatcaatggccagctctaccgaggctccttcggcatggccgcagagctcggc
cacctgccgatggtcccggacggagaccattgcggctgcggcctgcgcggctgcgccgag
cgctatacttcgggaacctcgctggagaacttcgccaagtccgccgtgcgtcgtcgtcct
caggacgccaaacgtcttctggagctgtgcggtggcgacatcaccaagctggagggaccg
atggtgtcccaagcggctcaggagggtgacgtgcttggcctgtatgcgttcggcaagatc
ggcgaatggcttggccgcaccatggccgccgtttccgccgtgcttgatccggacctgttc
gtcatcggcggtggtgtggtagccgttggagacattctgctggagccggcccgctacaac
taccagcgtttcctggaaggcagcgcctaccgtggccacgccaagatcgtcgccgcagtc
gcgggccaggacgccggcctcatcggtgccgccaatctggctcttcgctga

DBGET integrated database retrieval system