KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_2305Help
Entry
BLIJ_2305         CDS       T02092                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
blon03010  Ribosome
Brite
KEGG Orthology (KO) [BR:blon00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BLIJ_2305
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:blon03011]
    BLIJ_2305
Ribosome [BR:blon03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BLIJ_2305
  Bacteria
    BLIJ_2305
  Archaea
    BLIJ_2305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF4145
Motif
Other DBs
NCBI-ProteinID: BAJ69882
UniProt: B7GND5
Position
complement(2464240..2464599)
Genome map
AA seq 119 aa AA seqDB search
MEAKAIARHVRVTPRKARRMVDLIRGKKATEAVTILKFAPQAAALPVRKTLESAIANARV
KADKAGEPFRENDLYIKETYVDEGVTLKRFRARAQGRAARINKRTSHITVVVANKEGAR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaagcaatcgctcgtcacgtccgcgtgacgccgcgcaaggctcgccgcatg
gtcgacctcatccgcggcaagaaggcgaccgaagccgtcaccattttgaagttcgcccct
caggctgcggccctgccggtccgcaagaccctggagagcgccatcgccaacgctcgtgtg
aaggccgataaggccggcgagccgttccgcgagaacgacctgtacatcaaggagacctac
gttgacgaaggtgtgaccctcaagcgcttccgcgctcgtgcccagggccgcgccgctcgt
atcaacaagcgcacctcccacatcacggtcgtcgtggctaacaaggaaggagcccgctaa

DBGET integrated database retrieval system