KEGG   Salinivirga cyanobacteriivorans: L21SP5_00048Help
Entry
L21SP5_00048      CDS       T04172                                 

Gene name
alkH
Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
blq  Salinivirga cyanobacteriivorans
Pathway
blq00010  Glycolysis / Gluconeogenesis
blq00053  Ascorbate and aldarate metabolism
blq00071  Fatty acid degradation
blq00280  Valine, leucine and isoleucine degradation
blq00310  Lysine degradation
blq00330  Arginine and proline metabolism
blq00340  Histidine metabolism
blq00380  Tryptophan metabolism
blq00410  beta-Alanine metabolism
blq00561  Glycerolipid metabolism
blq00620  Pyruvate metabolism
blq00625  Chloroalkane and chloroalkene degradation
blq01100  Metabolic pathways
blq01110  Biosynthesis of secondary metabolites
blq01120  Microbial metabolism in diverse environments
blq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:blq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L21SP5_00048 (alkH)
   00053 Ascorbate and aldarate metabolism
    L21SP5_00048 (alkH)
   00620 Pyruvate metabolism
    L21SP5_00048 (alkH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    L21SP5_00048 (alkH)
   00561 Glycerolipid metabolism
    L21SP5_00048 (alkH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    L21SP5_00048 (alkH)
   00310 Lysine degradation
    L21SP5_00048 (alkH)
   00330 Arginine and proline metabolism
    L21SP5_00048 (alkH)
   00340 Histidine metabolism
    L21SP5_00048 (alkH)
   00380 Tryptophan metabolism
    L21SP5_00048 (alkH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    L21SP5_00048 (alkH)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    L21SP5_00048 (alkH)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    L21SP5_00048 (alkH)
Enzymes [BR:blq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     L21SP5_00048 (alkH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DRTGG DUF356
Motif
Other DBs
NCBI-ProteinID: ALO13730
UniProt: A0A0S2HUJ9
Position
complement(51151..52527)
Genome map
AA seq 458 aa AA seqDB search
MQDISALLKRQSAFFYEEANLNVDFRIKALNKLAEVIKKYEDPIHAALKADLGKSSYESF
ITETGFVQHEISFVKRHLKQWAKPQKVKKSLKLLFATKSYLHSEARGQVLIYAPWNYPFQ
LFMSPLIGAISAGNTVVLKPSEHAPTVSSVLEQMISEIFPEKYIAVVQGDATVAQELSKL
DWDMIFFTGSTAIGQKIYEQAAQKLIPVVLELGGKCPVLVHKDANLKVAARRIAWGKILN
AGQTCIAPDHIVVHKSVKDRLLKLLCKEFKAMLGKNPAESAAYARIVNKAHFERLVNMLD
QAEIFCGGNYNAEERYIEPTIVDNVQPAHTLMKEEIFGPILPVQSYENINDAILYINRLH
PPLAIYAFTGAKSTFEQIQRHTQSGAMVKNDVIMQLTNMYLPFGGVRQSGIGRYHGRFSF
EAFSYQRSFLHQTTWTDPAMRYPPYSEKKWKLIKKVLK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatatttcggcattactcaaacgtcagtctgcatttttttatgaagaagcaaac
ctgaatgtggactttagaataaaagcactaaacaagctcgcagaggttataaaaaaatat
gaagacccgatacatgctgccctgaaagccgatttgggtaaaagtagttatgaatctttt
attaccgaaacaggttttgtacagcatgaaataagctttgtaaaaagacacctcaaacaa
tgggcaaagccccagaaagtaaaaaagtcgttgaaattactctttgcgaccaaaagttat
ctacattctgaggcgcgggggcaggtgttgatttatgctccctggaattatccctttcag
ctatttatgtcaccattgattggtgctatttctgcgggaaatactgtggtgcttaaacca
tcggaacatgcacctacggtttcttctgtgctggagcaaatgattagtgaaatttttcct
gaaaaatatattgcggtagtgcagggtgatgctaccgtggcacaggagctgtcaaagctc
gactgggatatgatttttttcacaggatcgactgcaataggtcaaaaaatatatgaacag
gctgctcaaaaacttattcctgtagttttagaactgggaggaaagtgtccggtactggtc
cataaagatgccaatcttaaggttgctgcacgccgcattgcatggggcaaaattctgaat
gccggccaaacgtgcattgcccctgatcatatcgttgtgcataagtcggttaaggatcgt
ttgttgaagcttttgtgcaaggaatttaaagcaatgttaggcaaaaaccccgcagaatcg
gctgcttacgcgcgaatagtgaacaaggcccatttcgagcgattggttaatatgcttgat
caggccgaaatattctgtggtggtaactataatgctgaagaacggtatattgaaccaacc
attgttgataatgtacaacctgctcatactttgatgaaagaggagatttttggtcccata
ctaccagtgcagagctatgaaaatatcaatgatgccattctttatatcaacaggctgcat
ccgccattggctatatatgcttttacaggtgcaaaaagtacttttgaacagatacagcga
cacacgcaaagcggtgctatggtaaaaaatgatgtgattatgcaactgacaaatatgtat
ttaccctttggcggggttcggcaaagtggcattggtcggtaccatggccgctttagtttc
gaagctttttcataccaaaggtcttttttacatcaaaccacctggaccgatccggctatg
cgctatccgccatattccgaaaagaaatggaaactcattaaaaaggtactaaaatag

DBGET integrated database retrieval system