KEGG   Salinivirga cyanobacteriivorans: L21SP5_01427Help
Entry
L21SP5_01427      CDS       T04172                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
blq  Salinivirga cyanobacteriivorans
Pathway
blq00520  Amino sugar and nucleotide sugar metabolism
blq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    L21SP5_01427
Enzymes [BR:blq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     L21SP5_01427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-ProteinID: ALO15077
UniProt: A0A0S2HYI7
Position
complement(1717473..1718432)
Genome map
AA seq 319 aa AA seqDB search
MKKALVTGGAGFVGSHLCERLLNDGYEVISLDNYFTGDKRNILHLMDNPFFEVVRHDVTA
SYYAEVDEIYNLACPASPIHYQYNPIKTVKTSVMGAINMLGLAKRIKAPILQASTSEVYG
DPHVHPQTEDYWGHVNPIGRRSCYDEGKRCAETLFMDYHIQNKVRIKIIRIFNTYGPRMH
PSDGRVISNFIIQALQNQDITIYGDGSQTRSFQYVDDLVEGMIRMMKTDDEITGPINVGN
PGEFTIKELADMVIEMTGSASKVVNLPKPDDDPIQRRPDISKAHELLSGWEPEVALRQGL
EKTITYFDNLLKSGNFDTW
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcacttgttaccggtggtgccggttttgtgggatcacatttgtgtgaaaga
ctattgaatgatggttatgaagttatttccctcgataattattttacaggcgataagcgt
aatatattgcatttgatggacaacccgttttttgaagtagtcagacacgatgtaacagcc
tcatattatgcagaagtggatgaaatttacaatctggcctgtcctgcctctccaatacac
tatcagtataatcccattaaaacagtaaaaacatctgttatgggtgcaatcaacatgctg
ggccttgctaaacgcataaaagcaccaatactgcaggcatctacctcagaggtttacggt
gacccccacgtgcatccacaaactgaagattattggggacatgtaaatcctattggtcgc
agatcatgctatgacgaaggtaagcgatgtgctgaaacgctgtttatggattaccatata
caaaataaagtgcgcataaaaattatcaggatttttaatacctacggcccgcgtatgcac
ccaagcgatggtcgtgtaatttcaaatttcattatccaggcgcttcaaaaccaggatatc
actatttatggcgatggtagccaaacccgcagctttcagtatgtggatgatttggttgaa
ggtatgattcgaatgatgaagaccgatgatgaaattactggaccaatcaatgtgggcaac
ccgggagagtttacaataaaagaactggcagatatggtaattgagatgaccggttcagcg
tctaaagttgtgaaccttccaaaacccgatgatgaccctattcagaggcgacccgatatt
tcaaaagcccacgaattacttagtggctgggaacctgaagttgcgctcagacaaggactt
gaaaaaacaattacttattttgataatctattgaaatcaggtaatttcgatacctggtaa

DBGET integrated database retrieval system