KEGG   Salinivirga cyanobacteriivorans: L21SP5_02630Help
Entry
L21SP5_02630      CDS       T04172                                 

Definition
(GenBank) ComEC family competence protein
  KO
K02238  competence protein ComEC
Organism
blq  Salinivirga cyanobacteriivorans
Brite
KEGG Orthology (KO) [BR:blq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:blq02044]
    L21SP5_02630
Secretion system [BR:blq02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   L21SP5_02630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Competence DUF4131
Motif
Other DBs
NCBI-ProteinID: ALO16253
UniProt: A0A0S2I1U2
Position
3167038..3169080
Genome map
AA seq 680 aa AA seqDB search
MQDIIRNNPFLRLLIPFLAGILLGFCFNSSFDEVTTYIIYVLIGILGFTLLFAINRFIWL
QDLLIISIFFLFGVSRTADTYVEPQQYEDKVVFSAQISDYPDSTKNSLKLELDLGWQITD
SGRQEMRGNAFVYLSREDSISLDLGDYLLLKAKPDLIANQGNPGEFDFSGWAASKGFFYQ
FYVNDENWVRLNKTPEFNLSIYLKKLRRQIFNYYRKSGISDKQLAVFSALTLGDKSMLEH
DLRQGYVAAGLMHVLAVSGLHVGIIYLVISHLLKPLSKTQWGKILRFIISVFVLWGYAMF
TGMSPSVSRAATMFTVFVIGDLLGRRYAVYNSIALAAFILLFNNPLLIASVGFQMSFLAV
IGIVGFYPIVYRWIYIPWKTLDKIWQLMAVSIAAQIITTPLSLYYFHQFPLLFLLSNLLM
VPLATLLMYLFVLLLVFMPFPFIALRIGQVVDFFASLMNAFTGWIKALDWSTVSSVYISD
IQLVLLYLLVAVSTYWGIRTNYRNLKKVFIVLFLFVITVFWQNFIRTNNHSFIVFNTFGE
PLTMQISGQNYQLYNPDSIENTTWFTDPLKVKFGLNQSETRNAELVNSSPYVVWGKMPNR
AIFFDADLYPEHEKIKCKWLVLSSGSPFKLLPLLEKIEAVKVIADASVSQFKVEKWQEQL
KDSNIDFHNVKSEGAFVAKW
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatattattcgcaataatccgtttctgcggttgcttatacctttccttgcaggc
atattgctgggattttgctttaactcatcctttgatgaggttactacctatatcatttat
gttctgattggcatcttggggtttacattattgtttgcaataaacagatttatctggcta
caggatctgcttataatctcgatattctttttatttggagttagccgtacagcagataca
tatgttgagccgcaacaatatgaagataaagtggttttttcagctcaaatttctgattac
cccgatagcacaaagaatagtctcaaattagaactggatttgggctggcaaattacggat
tcaggaagacaagagatgaggggcaatgcatttgtttacctttccagggaggattcaata
agcctcgatttaggcgattaccttttattgaaagctaaaccagatttaattgccaatcag
ggaaacccgggagagtttgatttcagtggctgggctgcatctaaaggttttttttatcag
ttttatgtgaatgatgagaactgggtcaggctcaataaaaccccggaatttaatctatca
atatatctgaaaaagcttcgccggcaaatctttaattattatcgtaagtctggcataagc
gacaaacaactggcagttttttcggcacttaccctcggcgataaatctatgctcgaacat
gatttgcggcaaggctatgtggcagcaggattaatgcatgtgttggctgttagtggttta
catgtgggtattatttatcttgtgatttcgcatttattaaaaccactttcaaaaacccaa
tggggcaaaatacttcggtttataatttcagtatttgtgctgtggggttatgcaatgttt
acaggtatgtctccctctgtttcacgagctgctacaatgtttacagtatttgtaatcgga
gacttgctgggtaggcgttatgcagtttataattccattgcgcttgctgcatttattcta
ctttttaataatcctttattaattgccagtgtaggttttcaaatgtcttttcttgccgtt
attggaattgtagggttttacccaattgtttaccggtggatttacattccctggaaaacg
ctcgacaaaatttggcaacttatggcagtttctattgctgcccaaatcataaccacaccg
cttagcttatattattttcatcaattcccactgctatttttattgtcgaatttattaatg
gttccattggctaccttattaatgtatttgttcgtattgctactggtgtttatgccattc
ccttttattgctttgcgcatagggcaggtggtagatttttttgcttcattaatgaatgct
tttacaggctggataaaagctttagactggtctacagtaagctctgtgtacatatctgat
atacagctagtattgctttatttgttagtagctgttagtacatattggggcattagaacc
aattataggaatcttaagaaagtttttatcgtattgtttttatttgtaataacagttttt
tggcaaaatttcatacgaacaaataatcattcttttatagtgtttaatacttttggagag
ccattaaccatgcaaattagcgggcaaaactaccaactttataatcctgatagtattgaa
aacacaacctggttcaccgatccgcttaaagtaaaatttgggcttaatcaaagtgaaacc
cgaaatgctgaattagtcaatagttcgccttatgttgtatggggtaaaatgccaaataga
gccatttttttcgatgccgacctctatccggagcatgagaaaattaaatgtaaatggttg
gtcttatcttctggcagtccattcaaattattgccattgcttgaaaaaatcgaggccgtt
aaagtaatagctgatgcttctgtttcgcaatttaaggtagaaaagtggcaggagcaactc
aaagattctaacattgattttcataatgttaaaagtgagggggcttttgtcgcaaaatgg
tga

DBGET integrated database retrieval system