KEGG   Salinivirga cyanobacteriivorans: L21SP5_03345Help
Entry
L21SP5_03345      CDS       T04172                                 

Gene name
fhs
Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
blq  Salinivirga cyanobacteriivorans
Pathway
blq00670  One carbon pool by folate
blq01100  Metabolic pathways
blq01120  Microbial metabolism in diverse environments
blq01200  Carbon metabolism
Module
blq_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:blq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    L21SP5_03345 (fhs)
Enzymes [BR:blq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     L21SP5_03345 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS PRTP
Motif
Other DBs
NCBI-ProteinID: ALO16958
UniProt: A0A0S2I3L9
Position
complement(4051418..4053082)
Genome map
AA seq 554 aa AA seqDB search
MKSDIQIANEAKIQPITDIGSKLGIDSKDLELYGNYKAKVPLNYIDPEKVKKNNLILVSA
ISPTPAGEGKTTISIGLSQGLNHIGADSSVVLREPSLGPVFGIKGGATGGGMSQVLPMED
INLHFTGDFAAIEKAHNLLAAMIDNAVQHRTLNIDPRTVLWKRVMDMNDRSLRNSIVGLG
GRTSGFPRETGFDITAASEIMAILCLAEDFKDLKERIGNIFIGYTFDKKPVYARDLKAHG
AMAALLRDAIKPNLVQTLENTPAFIHGGPFANIAQGTNSVIATKMGMSLSDYVVTEAGFG
FDLGAEKFFDIKCQSSGLSPKAVVLVATARALKYHGGADLDKVNEPNMEALKAGISNLEK
HLENIQAFNVCAVVAINKFATDTDEELEYIKKRTEDRGIKAVVADVWGQGGKGAEDLATE
VKAVVDQCENKFKPMYDWEWDIPKKIETVAKNIYGAAAIDYTSRAKADLKKIKELGLDNL
PVCIAKTQKSLSDNPKLIGRPKDFVVTVREIELSSGAGFVVPITGKIMRMPGLPKAPSAE
KIDVDDDGNISGLF
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcagacatacaaattgcaaacgaggctaaaattcaaccgattaccgatatcgga
tcaaaactcggaattgacagtaaagatttagagctttacggaaattataaagcaaaagta
cctttaaattacattgatccggagaaagttaaaaagaacaatctaatactagtatcagca
atttccccaacccctgcaggagaaggaaaaacaacaatatcaattggtctgtcgcaggga
ttaaatcacattggagcagattcgagcgtcgtgctcagagagccctccttagggcctgta
tttggcattaaaggcggagccaccggtggcggaatgtcgcaggtgctgcccatggaagat
atcaatttgcactttacaggagattttgctgccatcgaaaaagcgcataacctgctcgcc
gcaatgatcgataatgcagtacagcatcgtacattaaatatcgatccgcgtactgtgctc
tggaaaagagtaatggatatgaatgaccgttcgctgcgtaattcaatagtcggacttggt
ggacgcacatcaggtttcccgcgtgaaacagggtttgacatcaccgcagcatcagaaatt
atggccattttatgccttgcagaagatttcaaagacctaaaagaacgcattggtaatata
ttcattggatacacatttgataaaaaaccagtttatgcacgcgaccttaaagcccacggt
gccatggccgcactgctacgcgatgccataaaacctaacctggtacaaacactcgaaaat
acgcctgcatttatacatggcggaccatttgcaaacattgcacagggtaccaactctgtt
attgccacaaaaatgggcatgtcattatctgattacgtagtaaccgaagctggttttgga
ttcgaccttggtgccgaaaaattcttcgacatcaagtgtcaatcatcagggttatcgcca
aaagcagtagtattggtagccactgcaagggcacttaagtaccacggcggtgccgacctt
gacaaggtaaatgaacccaatatggaagcactcaaagccggaatcagcaacctggagaaa
caccttgaaaatatacaggcatttaatgtttgtgcagttgtagcaattaacaaatttgcc
actgacaccgacgaagagttggaatacataaaaaaacgtaccgaggatcgaggcattaaa
gctgtagtagccgacgtttgggggcaaggaggtaaaggtgccgaagatttggccactgag
gttaaagcggttgttgatcaatgcgaaaacaaatttaaacccatgtatgattgggaatgg
gatattccgaagaaaattgaaactgtggctaaaaatatttatggtgccgccgctattgat
tacacctcaagagcaaaagccgatctcaaaaaaatcaaggagctgggtctcgataattta
ccggtttgtattgcaaaaacgcaaaaatcattatcagacaatcctaaactaattggccgc
cctaaagattttgtagtaactgtaagagaaatagagctatcatcaggcgccggatttgta
gtgcccattacaggcaaaataatgcgtatgcccggcttacctaaagcaccatcggctgaa
aaaattgatgtcgatgatgatggtaatatttcaggactattttaa

DBGET integrated database retrieval system