KEGG   Brevibacillus laterosporus: BRLA_c011570Help
Entry
BRLA_c011570      CDS       T03762                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
blr  Brevibacillus laterosporus
Pathway
blr00071  Fatty acid degradation
blr00072  Synthesis and degradation of ketone bodies
blr00280  Valine, leucine and isoleucine degradation
blr00310  Lysine degradation
blr00362  Benzoate degradation
blr00380  Tryptophan metabolism
blr00620  Pyruvate metabolism
blr00630  Glyoxylate and dicarboxylate metabolism
blr00640  Propanoate metabolism
blr00650  Butanoate metabolism
blr00900  Terpenoid backbone biosynthesis
blr01100  Metabolic pathways
blr01110  Biosynthesis of secondary metabolites
blr01120  Microbial metabolism in diverse environments
blr01130  Biosynthesis of antibiotics
blr01200  Carbon metabolism
blr01212  Fatty acid metabolism
blr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:blr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRLA_c011570
   00630 Glyoxylate and dicarboxylate metabolism
    BRLA_c011570
   00640 Propanoate metabolism
    BRLA_c011570
   00650 Butanoate metabolism
    BRLA_c011570
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BRLA_c011570
   00072 Synthesis and degradation of ketone bodies
    BRLA_c011570
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRLA_c011570
   00310 Lysine degradation
    BRLA_c011570
   00380 Tryptophan metabolism
    BRLA_c011570
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BRLA_c011570
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BRLA_c011570
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BRLA_c011570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:blr04147]
    BRLA_c011570
Enzymes [BR:blr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BRLA_c011570
Exosome [BR:blr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRLA_c011570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIG25497
UniProt: A0A075QYR6
Position
1213874..1215049
Genome map
AA seq 391 aa AA seqDB search
MAEPIVIVAAKRTPIGTFGGMFQDVSARKLAELTIRDIMDTTGIDPEDIDEVILGNCIQR
TDEPNIARTALLDAGLPQQVTGLTVQRQCSSGMQAIVSGLQQIALGDSEVVIAGGVESMS
RAPYVLKQARFGKRLMHGEMTDALWELLTDPHHDILMGETAERLADRYKISREEQDEIAY
LSHQKAAHATKEGLFKDEIIPIVLSKKNKTNTLTADEHIRPDITLDALATLKPTFREEGT
VTAGNASGLNDGASAVLLMKESKAKNLGLTVLGRIVSYAWAGVEPDLMGYGPVPATQKAL
KKAGLRLQDIQLIEVNEAFASQYLAVEKLLELDRTITNVNGSGISLGHPVGSTGCRLIVT
LLHEMKRRQLHRGLATLCVGGGLGMSMIVER
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcctatcgtaattgtcgcagcaaaacggacgcccattggaacatttggcggt
atgtttcaggatgtgtcagcacgtaaattagctgaactaacgattcgtgacatcatggat
acaacagggatcgaccccgaagacattgatgaggttattctaggtaattgtattcaacgt
acagatgagccgaatattgcaagaacagctcttttagacgctggtctgccccagcaagtg
acaggattgactgttcagcgacaatgttcctccggtatgcaggcaattgtttcaggtctg
caacagatagctttaggagatagcgaggttgtaatcgcgggcggtgtggagagcatgagt
cgcgctccttatgtcttgaagcaggcccgttttggcaagaggctcatgcatggtgaaatg
acagacgctttatgggagctgcttacagacccgcatcacgatattttaatgggtgaaaca
gcagaacgtttggcggatcgctataagatcagccgggaggagcaggatgagatcgcttat
ttaagtcatcagaaagcggcgcatgccacgaaagaggggctttttaaggacgaaatcatc
ccgattgttttgagtaaaaaaaataaaacgaacacgctcaccgcagatgagcatattcgc
ccagacattacgctcgatgccttagctacattaaagccaacctttcgtgaggagggaacg
gttacagcggggaatgcttcaggcttaaatgatggtgcctctgccgtgctattaatgaaa
gagagtaaagctaaaaatcttggacttactgtactagggcgcattgtatcttacgcatgg
gccggagtcgagcctgacttaatggggtatggaccagtgccagccacacaaaaagccttg
aagaaagcagggcttcgtttgcaagacatacaactgattgaggttaatgaagcatttgct
tctcagtatttggcggtagaaaagctattggaattggatcgaaccattacgaacgtaaat
ggcagtgggatatcgcttggtcatccagtcggctcaacaggctgccgcttaatcgtcacc
ctcctgcatgaaatgaaacgccgccagctgcatagagggttagctactttatgtgtaggt
ggcggactgggtatgagtatgattgttgaacgataa

DBGET integrated database retrieval system