KEGG   Brevibacillus laterosporus: BRLA_c028580Help
Entry
BRLA_c028580      CDS       T03762                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
blr  Brevibacillus laterosporus
Pathway
blr00670  One carbon pool by folate
blr00790  Folate biosynthesis
blr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BRLA_c028580
   00670 One carbon pool by folate
    BRLA_c028580
Enzymes [BR:blr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BRLA_c028580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AIG27172
UniProt: A0A075R3R1
Position
complement(3247103..3247600)
Genome map
AA seq 165 aa AA seqDB search
MLSSIFAMGQNRVIGRDNQLPWRLPEDLKYFRRITTGHAIIMGRKTYESIGKPLPNRRNI
VLTTQENYKADGCEIAHSIEEVLSLIDHKEEAFIIGGAEIYKLLLPFTSKMYITKIGQEF
EGDAFFPAFDESEWALVEVTPGVQNEENPYQYEFQIYVRSVTNCK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgctttcaagcatttttgctatgggtcagaaccgtgttattgggagagataaccagctc
ccatggcgattgccagaggatctcaagtattttcgacgcattaccactggtcatgctatc
atcatggggcgtaaaacctacgaatcaattggaaagcctttgcctaatcggcgtaatatc
gtgctgacgacacaggaaaactataaggcggatggctgtgaaatcgctcattcgatcgaa
gaagttctgtccctgattgatcataaagaagaagcctttattattggtggggcggaaatt
tataagctattattgcctttcactagcaaaatgtacattacgaagattgggcaggaattc
gagggagatgccttttttccagcctttgatgaatctgaatgggcattagttgaagtgaca
ccaggtgtacaaaacgaagagaatccatatcagtatgagttccaaatatatgttcggagt
gtaacgaattgtaaatag

DBGET integrated database retrieval system