KEGG   Brevibacillus laterosporus: BRLA_c035580Help
Entry
BRLA_c035580      CDS       T03762                                 

Definition
(GenBank) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
  KO
K05822  tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
blr  Brevibacillus laterosporus
Pathway
blr00300  Lysine biosynthesis
blr01100  Metabolic pathways
blr01110  Biosynthesis of secondary metabolites
blr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BRLA_c035580
Enzymes [BR:blr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     BRLA_c035580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapH_N Hexapep Hexapep_2 Fucokinase
Motif
Other DBs
NCBI-ProteinID: AIG27870
UniProt: A0A075RET7
Position
complement(3916464..3917174)
Genome map
AA seq 236 aa AA seqDB search
MNMMNAHEIISFIQKSEKKTPVKVHVKGNLEGIDFGQNTKTFITGNVGVLFGEWKDVQPV
LEANKDSIEDYVVESDRRNSAIPMLDTKEIQARIEPGAIIRDQVHIGNNAVIMMGAVINI
GASIGEGTMIDMGVIIGGRGTVGNNCHIGAGAVIAGVIEPPSATPVIIEDDVLVGANAVI
LEGVRIGKGSVVAAGAVVTQDVPANVVVAGTPARILKEIDAKTKSKTEIMQELRQL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgatgaatgcccacgaaattatcagctttattcaaaagagcgagaagaagacg
cctgtgaaggttcatgtaaagggaaatttagaaggaattgattttggtcaaaatacaaaa
acctttattacaggcaatgtaggtgtattgtttggcgaatggaaggacgtacagcctgtg
cttgaagccaataaggacagcattgaggactatgtggtagagagcgatcgtcgcaattct
gcgatcccgatgctagatacaaaagaaattcaagcgcgtattgagccaggtgctatcatt
cgtgatcaagtacacattggaaataatgcagtaattatgatgggtgcagtaattaatatc
ggtgcttctatcggagaaggtactatgatcgatatgggcgttattattggcggacgcggt
acggttggtaataattgccacattggagcaggagctgtcatagcgggtgttatcgagccg
ccttctgccacacctgtaattattgaggatgatgtattggttggagcaaatgctgttatt
ttagagggtgtgcggattggtaaaggctcagtggttgctgcgggagctgttgtaacacag
gatgttcctgcaaacgtagtagtggctgggacaccggcaagaatcctaaaagaaattgat
gcaaaaaccaaatccaaaacagagattatgcaagaactgcgtcagctataa

DBGET integrated database retrieval system