KEGG   Brevibacillus laterosporus: BRLA_c044600Help
Entry
BRLA_c044600      CDS       T03762                                 

Definition
(GenBank) fructose-1,6-bisphosphatase class 2
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
blr  Brevibacillus laterosporus
Pathway
blr00010  Glycolysis / Gluconeogenesis
blr00030  Pentose phosphate pathway
blr00051  Fructose and mannose metabolism
blr00680  Methane metabolism
blr01100  Metabolic pathways
blr01110  Biosynthesis of secondary metabolites
blr01120  Microbial metabolism in diverse environments
blr01130  Biosynthesis of antibiotics
blr01200  Carbon metabolism
Module
blr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:blr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRLA_c044600
   00030 Pentose phosphate pathway
    BRLA_c044600
   00051 Fructose and mannose metabolism
    BRLA_c044600
  09102 Energy metabolism
   00680 Methane metabolism
    BRLA_c044600
Enzymes [BR:blr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BRLA_c044600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AIG28724
UniProt: A0A075RA24
Position
complement(4872522..4873484)
Genome map
AA seq 320 aa AA seqDB search
MERSLTLELVRVTEAAALASARWMGTGKKDEADGAATQAMRSEFENIPMDGVVVIGEGEM
DEAPMLYIGERLGQGVAPFVDVAVDPLEGTNIVAKGTWNAISVIAIADRGNLLHAPDMYM
EKIAVGPNAVGKVDIDAPIRDNLKAVALANGKDMSDLVACVLDRDRHSRIIEEIRAAGAR
IKLIPDGDVAAAINTAFPDTGVDILFGSGGAPEGVLAAVALKCLGGEIQGKLLPQNDEEL
QRCLKMGLTNPHQVLHMDQLVKGDDAIFAATGVTDGELLKGVRFQGTRATTHSVVMRAKT
GTIRFIEGNHRLEKKPGLVL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcagtctcacacttgaattggttcgtgtaacggaagcggcggccttggcttcc
gcaagatggatggggacaggtaaaaaggatgaagcagatggggcagcaacacaagcgatg
cgatctgaatttgagaatatacctatggatggtgttgtagtaattggggaaggcgaaatg
gatgaagcgcctatgctctacattggtgagagattagggcagggtgtggcgcctttcgta
gatgttgcagtcgatccgcttgaggggacgaacattgtagctaaaggtacatggaatgct
atctctgtcattgcgattgccgatagagggaatttgttgcatgcgcctgacatgtacatg
gaaaaaattgcagtaggccccaatgcggtagggaaagtagacattgatgcgccaatacgt
gataatttaaaagctgttgctctagcaaatggaaaagatatgagcgatttagtcgcctgt
gtgctggatagggatcggcatagtcgcattattgaagagattcgtgcagccggagcccgt
ataaaattaattccagatggagacgtagcggcagcaattaatactgcctttcctgataca
ggtgtggatattctatttggatcaggtggagctcctgaaggggttttagcagccgtagct
ctaaagtgtttaggtggagaaattcagggcaaattattgcctcaaaatgatgaagaactg
caacgatgtttgaagatgggtctgaccaacccacaccaggttttgcatatggatcagttg
gttaaaggagacgatgccatttttgcagctacgggtgttacggatggagaattgctgaaa
ggcgttcgttttcagggaacgagagcgacaacacattctgtggtaatgagggccaaaaca
ggaacgattcgtttcattgaaggtaaccaccgcttagaaaagaaacctgggttagtatta
tag

DBGET integrated database retrieval system