KEGG   Bifidobacterium animalis subsp. lactis Bi-07: W91_0869Help
Entry
W91_0869          CDS       T02080                                 

Definition
(GenBank) hypothetical protein
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bls  Bifidobacterium animalis subsp. lactis Bi-07
Pathway
bls00220  Arginine biosynthesis
bls00250  Alanine, aspartate and glutamate metabolism
bls00290  Valine, leucine and isoleucine biosynthesis
bls01100  Metabolic pathways
bls01110  Biosynthesis of secondary metabolites
bls01130  Biosynthesis of antibiotics
bls01210  2-Oxocarboxylic acid metabolism
bls01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bls00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    W91_0869
   00290 Valine, leucine and isoleucine biosynthesis
    W91_0869
   00220 Arginine biosynthesis
    W91_0869
Enzymes [BR:bls01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     W91_0869
    2.6.1.66  valine---pyruvate transaminase
     W91_0869
Amino acid related enzymes [BR:bls01007]
 Aminotransferase (transaminase)
  Class I
   W91_0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 HTH_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AFJ18154
Position
complement(971309..972988)
Genome map
AA seq 559 aa AA seqDB search
MTDFTTRLNQAMELRNIKQIDFVKAAQDHGVKLGRSHISQYVSGKTRPRRDIERFLAAVL
RVNADWLAGESVPFDDDPETFAKIEHVSPDADFEHIKRVEQNSSIQNSEHIEHNNELAEI
EQEQDMEAAANNNVQDPSFPDVPSSVTSEPMNIGSRRVFTKSHKLDNVLYDVRGPVVNEA
ARMEAAGMHVMKLNIGNPAPFGFRTPDEVVYDMAQQLTDTEGYSASKGLFSARKAIMQYA
QLKNLPNVGVEDIYTGNGVSELINLSMSALLDDGDEVLLPAPDYPLWTACVTLAGGKPVH
YVCDEQSEWYPDIDDMRAKITDRTKAIVIINPNNPTGALYPTEVLQQIVELARQHQLMIF
SDEIYDRLVMDGLTHTSIASLAPDLFCVTYSGLSKSHMIAGYRIGWMILSGNKSIAKDYI
EGLDMLTNMRICSNVPAQSIVQTALGGHQSVNDYLVPGGRIYEQREYIYNALNSIDGITA
VKPKAAFYIFPKIDAKKFNIRNDEQFALDLLHDEKLLIVQGTGFNWKDPDHFRVVYLPRV
EVLKGAVDKMTHFFSHYRQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcaccacgcgcctcaatcaggcgatggagttgcgcaacatcaagcagatc
gacttcgtcaaagcggcgcaggaccatggagtcaagctggggcgcagccacatcagtcaa
tatgtgagcggcaaaacaagaccgcgccgcgatattgagcgattcctcgcggctgtgttg
cgggtgaacgcggattggctggcaggcgagagcgtgccgttcgacgatgatcctgaaacc
ttcgcaaagattgaacacgtgagtccagacgccgattttgaacatatcaagagagttgaa
cagaatagttcgattcagaattctgaacatattgaacataacaatgaactcgctgaaatt
gaacaggagcaagacatggaagcggcagcgaacaataatgtgcaggacccctcgttccct
gatgtgccatcaagtgtcacatcggaacccatgaacatcggctcccgacgggtcttcacc
aagtcacataaactggacaacgtgctctatgacgtacgcggaccggtggtcaacgaggcg
gcgcgcatggaagcagccggcatgcatgtgatgaaactcaatataggcaatccagcccca
ttcggattccgtacaccggacgaagtcgtctatgacatggcacaacagctcaccgatacg
gaagggtattcggcgtcaaaggggctcttctcagcccgtaaggcgatcatgcagtacgct
cagctcaagaacctgccgaatgtgggagtagaagacatctacactggcaacggtgtgagc
gagctcatcaacctcagcatgagtgcgttgttggacgacggggacgaagtgctgctaccg
gcccccgactatccgttgtggacggcatgcgtcaccctggcaggcggcaaaccagtgcat
tacgtctgcgacgaacagtcggagtggtatccggacatcgacgatatgcgtgccaagatc
accgatcgcaccaaggcaatcgtcatcatcaacccgaacaatccgacaggcgcgctctat
ccgaccgaggtgctgcagcagatcgtcgaactggcgcggcagcaccagcttatgatcttc
tccgacgagatctatgaccgcctcgtcatggatgggctcacccacacgtcaatcgcctcc
ctcgcccccgacctgttctgcgtgacctatagcggtttgtcgaagtctcatatgatcgcc
gggtaccgcatcggctggatgatcctgtcaggcaacaagtcgatcgcgaaggattacatc
gaaggccttgacatgctcacgaacatgcgcatctgctcgaatgtacccgcccaatcaatc
gtgcagacggcattgggaggccatcagagtgtcaacgactacctcgttccggggggccgt
atatacgaacagcgtgaatacatctacaacgcgctgaactcaatcgatggcatcacggcg
gtcaaaccgaaggcggccttctacatcttcccgaaaatcgatgcgaagaaattcaacatt
cgcaacgacgagcaattcgcgctcgatctgctgcacgacgagaaactgctcatcgtgcag
ggcaccggtttcaattggaaggacccggaccatttccgtgtggtctacctgccgcgcgtc
gaggtgctcaaaggcgccgtcgacaaaatgacacacttcttcagccactatcgccaatag

DBGET integrated database retrieval system