KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_1239
Entry
Balat_1239        CDS       T00924                                 
Name
(GenBank) LacI-type transcriptional regulator
  KO
K02529  LacI family transcriptional regulator
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Brite
KEGG Orthology (KO) [BR:blt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:blt03000]
    Balat_1239
Transcription factors [BR:blt03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    Balat_1239
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 TetR_N HTH_31 Activator-TraM
Other DBs
NCBI-ProteinID: ACS48162
Position
1430815..1431873
AA seq 352 aa
MTTMKEIAQAAGVSVSSVSLVLNGRDSGRINPQLANRIRETAERMGYQPNVLARSLRTNR
TYMIGFISVEVATTPYAGGMIQGAQDALSSLGYMLLTVNGDTEQALESEIRALKRYGVDG
FLYSAMSNRVMTVPKSLAKFPLVLVDAAEETNRFPSIEPDEFRIGYDATTRLIEAGCSRI
AYVGCAEPMVAQTGRLAGYRQALMDHGRGFDERLQCDVLNNGPALRAVEALFDTEQPNGF
FCFNDARAWYVYETAARHGLAVGRDISVVGVDNHRVFAETLEPQLTTIELPHYEMGYWAA
NKLVSMIENRPLNEGDWPHTTAVMPLLDTPSPVKVHCTLIEKGSVRDTPTTA
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgacgacgatgaaggaaatcgcacaagcggccggagtctccgtctcctcggtctcgctc
gtgctcaatgggcgtgattcggggcgcatcaatccgcagcttgcgaaccgcatacgcgaa
accgcagagcgaatggggtaccagcccaatgtgctggcccgctccctacgcaccaaccgg
acgtatatgatcgggttcatcagcgtcgaagtggccaccacgccatatgcgggcggtatg
atccaaggtgcacaggacgccttgagctcgcttggctacatgctcctcaccgtgaacgga
gacaccgaacaggccctggaaagcgagatccgcgctctgaaacgctacggtgtggatggc
ttcctgtattccgcgatgtcgaaccgcgtgatgacggtgcccaaatcactcgccaagttc
cctctggtgctcgtcgacgccgcagaggagaccaatcgcttcccgtccatcgaaccggac
gagttccgcatcggctatgacgccaccaccagactcatcgaagccggatgctcccgcata
gcgtatgtgggatgcgccgaacccatggtggcacagaccggcaggctcgccggttaccga
caggccctgatggaccacggcaggggcttcgacgaacgactgcaatgcgacgtgctcaac
aacgggccggcactacgtgccgtggaagcgttattcgacaccgagcagcccaacggattc
ttctgcttcaacgacgcacgcgcctggtatgtatacgagacggcggcacgacatggactg
gccgtcggacgcgacatctcggtggtcggcgtggacaaccatcgcgtatttgccgagaca
ctcgagccgcaactcaccaccatcgaactgccccactacgagatgggctactgggccgcg
aacaagctcgtgtcgatgatcgagaaccgcccgctcaatgaaggcgattggccccatacg
accgcggtgatgcctctgcttgacacgccatcgccggtgaaggtgcactgcacgctgatc
gagaagggatcggtgcgcgacacgccgacgaccgcgtga

DBGET integrated database retrieval system