KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_0291Help
Entry
BalV_0291         CDS       T01843                                 

Definition
(GenBank) dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
blv00300  Lysine biosynthesis
blv01100  Metabolic pathways
blv01120  Microbial metabolism in diverse environments
blv01230  Biosynthesis of amino acids
Module
blv_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:blv00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BalV_0291
Enzymes [BR:blv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BalV_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADG32879
Position
366799..368019
Genome map
AA seq 406 aa AA seqDB search
MQDVIDRAGEPLKLTVDAGVGEQAALTDLCMQVMRVYSVSDDETHLTDMTEAFLRTLPHL
DVQRHGDTLVARTNLGRDRRVVLAGHLDVVPVIDNFPPKLLEPGDPLILPGVAEAHPGER
VVWGRGATDMKSSDAVLLYLAATLTNPKYDLTYVFYDHEEVAAEKNGLRKVAEAHPDWIA
GDFAIIGEPTSCGIEGGCNGTIRFDVVTHGIAAHSARAWMGHNAIHDAAEILRRLNEHTD
ATVSVDGLVYREGLNATLISGGKGTNVIPDECRVHVNYRFAPDKSLAEAKALMMGADCGA
ELGNGEHQATGGVFEGFGIEMKDESPSARPGMDSELTRSLAALAKARTGKDPEAKLGWTD
VARFSQLGVPAVNFGAGSPLLAHKHDEQVAEGELTLMAGILRDWLS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtgatcgatcgcgcgggggagccgctcaagctgacggtggacgccggtgtg
ggcgagcaggccgcgctcaccgacctgtgcatgcaggtgatgcgcgtgtactcggtgagc
gacgacgagacgcatctgaccgacatgaccgaggcgttccttcgcacgctgccgcatctg
gacgtgcagcggcatggcgacacgctcgtcgcgcgcacgaatctcggccgtgacaggcgc
gtggtgctcgccggccatctcgatgtggtgccggtgatcgacaacttcccgccgaaactg
ctcgaacccggagacccgctcattctgccgggcgtcgcggaggcgcacccgggcgaacgc
gtggtgtggggacgtggcgccaccgacatgaaatcgtcggacgccgtgctgctttacctt
gccgcgacgctgacgaacccgaaatacgatctgacttacgtgttctacgaccacgaggag
gtggccgccgagaagaacggcctgcgcaaggtcgccgaagcgcacccggactggatcgcc
ggcgatttcgcgatcataggcgagcccacctcatgcggcattgaaggcggctgcaacggc
acgatccgcttcgacgtggtcacgcacggcatagccgcacattccgcacgcgcgtggatg
ggccacaacgccatccacgacgccgccgagattctgcgccgtctgaacgagcatacggac
gccactgtgagcgtggacggtctcgtctaccgcgaagggctcaacgcgacgctgatcagc
ggcggcaagggcaccaatgtgatccccgatgaatgccgcgtgcacgtcaactaccgtttc
gctcccgacaaatcgctcgccgaggcgaaggcgctgatgatgggcgcagactgcggtgcc
gaactcggcaacggcgagcaccaggcgacgggcggtgtgttcgagggcttcggcattgag
atgaaagacgaatcgccgtcggcacgacccggcatggattccgaactcacgcgctcgctg
gcggctctggcgaaggcacgcaccggcaaggaccccgaggcgaagctcggctggaccgac
gtcgcccgattctcgcagctcggtgttccggccgtcaacttcggcgccggttcgccactg
ctcgcgcacaagcacgacgagcaggtggcggaaggcgaactgacgctcatggccggcatt
ctgcgcgactggctgagctga

DBGET integrated database retrieval system