KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_0816Help
Entry
BalV_0816         CDS       T01843                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
blv00010  Glycolysis / Gluconeogenesis
blv00051  Fructose and mannose metabolism
blv00562  Inositol phosphate metabolism
blv01100  Metabolic pathways
blv01110  Biosynthesis of secondary metabolites
blv01120  Microbial metabolism in diverse environments
blv01130  Biosynthesis of antibiotics
blv01200  Carbon metabolism
blv01230  Biosynthesis of amino acids
Module
blv_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BalV_0816
   00051 Fructose and mannose metabolism
    BalV_0816
   00562 Inositol phosphate metabolism
    BalV_0816
Enzymes [BR:blv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BalV_0816
Exosome [BR:blv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BalV_0816
  Exosomal proteins of bladder cancer cells
   BalV_0816
  Exosomal proteins of melanoma cells
   BalV_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADG33404
Position
complement(974346..975158)
Genome map
AA seq 270 aa AA seqDB search
MASTRRIPMVAGNWKMNFDHLEATEFVRAFSKNLKRCHFDFNRCEVALFPSFTSIRSVQV
MVESEHLRIRYGAQAVSVTSQGAFTGDVSADMLAHLGCSYVIVGHSERRKYHPEDDANIV
DQVRAVLAAGMQPILCVGESLEERRKGIELEFAVGQVHDVTRDLSDGEASKLIIAYEPVW
AIGTGMVATPQTAQDAAHAFRVDLAKSFGDHVAQTVRVLYGGSVSSKNCVELIEEPDVDG
FLIGGAALDVDELTTICRKTIATTSSHDNS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgacacgacgcatccccatggttgcgggcaattggaagatgaacttcgatcat
cttgaggcgaccgagttcgtccgggcattctccaagaacctcaaacgatgccattttgac
ttcaatcgttgcgaagtggcgctcttcccgtcattcacctcgattcgtagcgttcaggtg
atggtggaatccgaacacttgcgcatcagatacggggcccaggccgtttcggtcacgtca
cagggggcgttcaccggtgacgtctctgcggacatgctcgcgcatctgggttgcagctat
gtgattgtaggccattcggaacggcgcaaataccatccggaggacgatgcgaacatcgtc
gatcaggtacgagcggtgcttgccgccggcatgcagccaatcctatgcgtcggcgagagt
ctggaggagaggcgaaagggcattgaacttgagtttgccgtcggacaggtgcatgacgtg
acacgcgacctttccgatggggaggcatcaaaactcatcatcgcctatgaacccgtctgg
gcgattggcacgggcatggttgctacaccgcagacagcgcaggacgccgcccatgccttc
cgcgtggatctggcgaaatcattcggcgaccatgtggcgcagaccgtgcgtgtactgtat
ggaggctcggtgtcttcgaagaactgtgtggagctgattgaggagccggacgtcgacggc
ttcctcatcggaggtgccgccctcgacgtcgatgagctcaccacaatctgcaggaagacg
attgcgacaacatcttcacatgataatagttga

DBGET integrated database retrieval system