KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_1375Help
Entry
BalV_1375         CDS       T01843                                 

Definition
(GenBank) glucan endo-1,6-beta-glucosidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
blv00511  Other glycan degradation
blv00600  Sphingolipid metabolism
blv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    BalV_1375
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BalV_1375
Enzymes [BR:blv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BalV_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59
Motif
Other DBs
NCBI-ProteinID: ADG33963
Position
complement(1672777..1674231)
Genome map
AA seq 484 aa AA seqDB search
MIQAFSTYANAQGTTLAAAFAPLGNAYLRVGRTPESTSHASTPTLSIDTTRVRQPIDGFG
ASITEATSWLWHNRVTDKERCIRDLFSPRDGIGISMLRQPIGPSDHVSAPYRFVRRFPDR
NLNSLDFTPEMERVLPMVEAANDCALATQSHALNIMASPWSAPWWMKTNLSVLGKRRYTR
ITGHLRRGMYAAYARYITGFARLYAQRGLPLFALTVTNEPDYPQSRWPSMAMTPREQAEF
VARHLRPMLDHAGLEGTRILCWDHNYSTDHYPDGAFVRDMYADSAALTACAGSAWHYYGG
SARTMSRIHDAFPNKGIWATEASGGDWGPRNFTPALLSLGTAVIDMMNNWARSAVLWNIA
LDEHGGPDYYYLRNDRRHSENRGLITVRDDGSIRRNADYYALGHFSKYVPIGSRCVECAL
DHAQGVRAAAFLVPAALTHGDGDQVVAVLVNSRPEPLDLLCHLRGAGNGVMLTLPASSLT
SFLA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgattcaggcattctcaacatacgcgaatgcgcagggcaccacgcttgccgccgcgttc
gcgccgcttgggaatgcctatttgcgtgtagggcgcacgccggagagcacgtcacacgcc
agcacccccacgctcagcatcgacacgactcgcgtgcgccagcccatcgacggcttcggc
gcatcgatcaccgaggcgacgagctggctgtggcacaatcgcgtcacagacaaagagcga
tgcatccgcgatctgttcagcccgcgcgacggcataggcatctcgatgctccgtcagcca
atcggcccaagcgaccatgtgagcgcgccgtaccgcttcgtgcgcagattccccgaccgc
aatctcaactccctcgatttcacacccgagatggagcgcgtgttgcccatggtcgaggcc
gcgaacgactgtgcgctcgccacgcaatcgcatgcgctcaacattatggcgagcccgtgg
agcgcgccatggtggatgaaaacgaatctcagcgtgctcggcaaacggcgctacacgcgg
atcaccggccatctgcggcgcggcatgtatgccgcctatgcgcgctatatcaccggtttt
gcgcgattgtatgcgcagcgcggactgccgctgttcgcgctcaccgtgacgaacgaaccc
gactacccgcagtcgcgatggccatcgatggcaatgaccccgcgcgagcaggcagagttc
gtcgcgcgccatctgcgccccatgctcgaccacgccggattggaaggcacgcgcattctg
tgctgggaccacaactactccaccgaccattatccggacggcgccttcgtgcgagacatg
tacgccgattccgccgcgctcaccgcctgcgccggctccgcatggcattattacggcgga
tccgcgcgcacgatgtctcgcattcacgacgcgtttccgaacaagggcatctgggcgacc
gaggcgagcggcggcgactgggggccgcgcaatttcacacccgcgctgctctcgctgggc
acggcggtcattgacatgatgaacaactgggcgaggagcgccgtgttgtggaacatcgcg
ctcgacgagcacggcggtcccgactactactacctgcgcaacgatcgccggcattccgag
aaccgtggtctgatcactgtgcgtgacgacggttcgatacgccgcaatgcagactactac
gcgctcggccacttctccaaatacgtgccgattggctcacgttgcgtggaatgcgcgctc
gaccatgcgcaaggtgtgcgtgccgccgccttcctagtccctgccgctcttactcatggt
gatggtgaccaggttgttgccgtgctcgtgaactctcgccccgagccgctcgacctgctg
tgccatctgcgcggtgcaggcaacggcgtgatgctgacattgccggcttcctccctcacc
tctttcctggcatga

DBGET integrated database retrieval system