KEGG   Bifidobacterium longum BXY01: GS08_10135
Entry
GS08_10135        CDS       T03387                                 

Definition
(GenBank) carbohydrate-binding protein
  KO
K24100  galactan exo-1,6-beta-galactobiohydrolase (non-reducing end) [EC:3.2.1.213]
Organism
blx  Bifidobacterium longum BXY01
Brite
KEGG Orthology (KO) [BR:blx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GS08_10135
Enzymes [BR:blx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.213  galactan exo-1,6-beta-galactobiohydrolase (non-reducing end)
     GS08_10135
SSDB
Motif
Pfam: Big_3 F5_F8_type_C RicinB_lectin_2 Big_4 Cadherin-like DUF5344
Other DBs
NCBI-ProteinID: AIF91426
Position
complement(2349799..2354340)
AA seq 1513 aa
MRVLSKSLAAMVAAATLVGGGAFAVAGTAYAADNDAITVTPNPWYANSFDGWGTSLAWFA
NATGSLGEESAITTNLGDDASKAKAVEYGKQLREQFYQSIFGDEGLDLNMARYNVGGGNA
SDVAYGYPFMRQGAAVPGTWKDDATGSGTYGNGVTTKQADKDKLAAAFDPTDDNQYDFSK
SAAQDWWIERGATGDNPDITDVEAFANSAPWFLTNSGYATGGYNSGSNNLANPEKFAQYM
AKNVEHLESLGANVDTVEPFNESETSYWGTPGDMASKYTDESDDNTKLINNYWDKYYSDK
DRSVTPYSNALKKPQEGMHVSNAQQQQTITALAEALKDNDDTIIAATDATNSADFVKSYN
QYPQAIKDLIGQYNVHAYSDSNQMQSRDIAQADGKKLSMSEVDGSWQSGSYNPYGFDNAL
GMMSKISSNVTRLQSKDFTFWQVVEDLYNMQMGSNVNPAGENTNWGTVLIDFDCTVAGMD
GKLYSERRVNNNGGTTDGLEPCTVIANAKYNGVKAITHFIHAGDKVIANNDEDNNMTATS
DDGKTQTVIHRNSGTSDQTFVIDLSKYGEIADNAYGELYLTTETSAEDKNAGVDSATPEV
FAKTSNVKQAEGSVMIDKAAKTATVTVPARSIASIQLTGVTGYAKDAAVETGDTYQLVGK
QSGKAVADTTSGDSALSLANVASDAENAKKQTWTFTQIEQPADSERPDLKAYVITNAEGK
VLVSKDGTNALSNETVEAAKSDPAAKWILNTSDGSTYQLLNAATKTNLDVDNSGTTVGTK
VGLWQSPSGTSPSANQTWTLRNVTPTSQKTVNVQTAVNEKAALPTEVTLYYTWGEGKATV
ANWDTSKVDVAKEGTYEATATATDVYGNEFNVAATVYVGALTVSDPVSATVLAGTSASEA
KAALEAAPVYLHVKASPAFEGDAAKVTWNFDGLDTKLADAKAGDNIAVTGTYQLDDATTI
ALKGAIYVTAATPENVADTASSLTVTNQQTEYSKGDQWKKLTDGDTSAEAWVTWNSAGDY
SASPTATIDFGSECELSRVTITYGDKAPASAKAEYTTDGETWMQFGSDVKPAAGQTVTFK
ADKGTVNATKVRIVNTVNNDYMNATEIQAFVTPVQGAAKNIAAASGTNFSVNFQEGASAS
KAIDGDTTSKGWSTWASTASTVDPVATFTFDEAQTITEVKTFFYYDGRASWPKSQTLEYQ
DEAGEWHEVGTKDGWKTQAGDAGSGSDGITAADTPTVDFVLDTPVKAKAIRLTNTLQDTK
VYINVAEIQVFAQDNKVITPQPASDATLGDLRLDGETIKGFAADKTDYTVDLPFGAEANP
VLQAFAADNAATVKVTGDAVENGKLGGKATITVTSADESETKTYTVTFKAFTLASLKVTG
PTKIEYAIGDKLDTAGLKVTAVYQSGDKTKEVPVALDDPQLAIGSFDSTTAGKKAITVSY
RGVTATFNVTVKANAVAPGPEEQKPGSTNKPGATGNGNKNTVANTGSNVAAIAGAVALLA
AAAGALFMLRKRA
NT seq 4542 nt   +upstreamnt  +downstreamnt
atgagggtactgagcaaatcgcttgctgcaatggttgcggcggcaacactagtgggagga
ggggcgtttgcggttgccggcactgcgtatgcggctgataacgatgccattaccgtgacc
ccgaacccgtggtatgccaacagtttcgatggctggggcacctcgctggcttggttcgcc
aacgccaccggcagcctcggcgaggaatcggccatcaccaccaatctcggcgatgacgct
tccaaggctaaggctgtggaatacggcaagcagctgcgcgaacagttctaccagtccatc
ttcggtgatgaaggactggacctgaacatggcccgctacaacgtgggcggcggcaatgcc
tccgatgttgcctacggctacccattcatgcgccaaggcgctgccgtgcctggcacgtgg
aaagatgacgccaccggctccggcacgtatggcaatggcgtaaccaccaagcaggccgac
aaagacaagctggctgcggcattcgacccgactgacgacaaccagtatgacttctccaag
tccgccgcccaagactggtggattgagcgcggtgccaccggcgataaccccgacatcacc
gatgtagaggccttcgccaactccgctccgtggttcctgaccaacagcggttacgccact
ggtggatacaactctggtagcaataatcttgcaaaccctgagaaattcgctcagtacatg
gccaagaacgtcgagcacctcgaaagccttggcgcaaacgttgacacggtcgagccgttc
aacgagtccgagaccagttactggggcactccgggcgacatggcttcgaagtacaccgat
gagagcgatgacaacaccaagctcattaacaactactgggataagtactactccgacaaa
gataggtccgtcaccccatactccaacgcgctgaagaagccgcaggagggtatgcatgtc
agcaacgcccagcagcagcagacgattaccgcactcgctgaggcgctcaaggacaatgat
gacaccatcatcgcagccaccgatgccacgaactccgccgacttcgtcaagtcgtacaac
cagtacccgcaggcgatcaaggaccttatcggccagtacaacgttcacgcctactccgac
agcaaccagatgcagtcgcgcgatatcgctcaggcagacggcaagaagctgtcgatgagc
gaggtggacggctcctggcagtctggctcctacaacccgtacggtttcgacaacgcgctg
ggcatgatgagcaagatcagctccaacgtcacccgcctgcagtccaaggacttcaccttc
tggcaggtggtcgaggacctctacaacatgcagatgggctcgaatgtgaatccggccggt
gagaacaccaactggggcaccgtgctcatcgacttcgactgcaccgtggctggcatggac
ggcaagctctactccgagcgccgcgtgaacaacaacggcggtaccaccgatggacttgaa
ccgtgcacggttattgcaaacgccaagtacaacggcgtcaaggccatcacccacttcatc
cacgcgggcgacaaggtcatcgccaacaacgatgaggacaacaacatgactgccacctcc
gacgatggcaagacacagaccgtcatccaccgcaactccggcacctctgaccagaccttc
gtcatcgacctgtcgaagtacggcgagattgccgacaacgcttacggtgagctctacctg
accaccgaaacctctgccgaagacaagaacgcgggtgtcgattccgccactccggaagtc
ttcgccaagaccagcaacgtcaagcaagctgaaggctctgtgatgattgacaaggctgcc
aagaccgctacggtcactgtgcccgcccgttctatcgcctccatccagctcactggcgtg
accggctacgctaaggatgctgccgtcgagaccggcgacacttaccagctcgttggtaag
cagtccggcaaggccgtggctgataccacttctggtgattccgcgctgtccctggccaac
gtcgcttccgatgccgagaacgccaagaagcagacttggacctttacccagatcgagcag
cccgccgactccgagcgccctgatctcaaggcttatgtgattactaacgccgaaggcaag
gtgctggtgtccaaggatggcacgaacgcgctttccaacgaaacggttgaggccgctaag
tccgacccggctgccaagtggattctcaacacttccgatggttcgacctaccagctgctc
aatgccgcgactaagacgaacctcgatgtggataactctggtaccacagtcggcacgaag
gttggcttgtggcagtcaccgagcggcacttcgccgtccgccaaccagacatggactcta
cgcaatgtaacgccgaccagccagaagaccgtgaacgtgcagaccgccgttaacgagaag
gccgcgctgccgaccgaagtcacgctctactacacctggggcgaaggcaaggccacggtt
gccaactgggatacttccaaggtcgatgtggccaaggaaggcacctacgaagccaccgct
accgccaccgatgtgtacggcaacgagttcaatgtcgccgctacggtctacgttggcgcg
ctcaccgtttccgatccggtatcggctacagtgctggccggcaccagtgcgagcgaggcg
aaggccgcgcttgaggctgcgccggtgtatctgcacgtcaaggcatcgcctgcattcgag
ggcgatgcggctaaggttacgtggaacttcgatgggcttgataccaagctcgccgatgcc
aaggctggcgacaacattgccgtgaccggtacttaccagctggacgacgcgaccacgatt
gcgctgaagggcgcgatctatgtcaccgccgccacgcctgagaatgtggccgacactgct
tccagcctgaccgtgaccaaccagcagacggaatacagcaagggcgatcagtggaagaag
ctcaccgatggtgacacgtcagctgaagcctgggtgacgtggaactctgctggtgactat
tccgccagcccgaccgccacgattgacttcggctctgagtgtgagcttagcagagtgacc
attacgtatggtgacaaggctccggcttccgccaaggccgagtacaccactgatggcgag
acgtggatgcaattcggtagcgatgttaagcctgccgcaggccagacggtgacgttcaag
gccgataagggcacagtgaatgccacgaaggtgcgcattgtgaacaccgtgaacaacgac
tacatgaacgccaccgaaattcaggcattcgtgacgccggttcagggtgctgcgaagaac
atcgccgcggcctctggcacgaacttctcggtgaacttccaggagggtgcctccgcttcc
aaggccatcgatggtgacactacgtcaaagggttggtccacttgggcttccaccgcctcg
acggtggacccggtcgccacgttcaccttcgacgaagctcagaccatcaccgaagtgaag
accttcttctactacgatggtcgtgcgtcttggccgaagagccagacgctggaataccag
gatgaggctggcgaatggcatgaagtcggtaccaaggatggctggaagacacaggccggc
gatgccggctctggctccgacggcatcaccgccgccgacaccccgaccgttgacttcgtg
ctcgacaccccggtaaaggccaaggccatccgcctgaccaacacgttgcaggacaccaag
gtgtacatcaacgtggccgaaattcaggtgttcgcacaagacaacaaggtgattaccccg
cagccggcatccgatgccacgctgggcgacctgcgtcttgacggcgagaccatcaagggc
ttcgctgctgataagaccgactacacagttgatcttccgttcggtgctgaggcaaacccg
gtgctgcaggccttcgccgccgacaatgccgccaccgtcaaggtgactggcgacgcggtt
gagaatggcaagcttggcggcaaggccaccattacggtgacctcagccgacgagtctgag
acgaagacctacacggtgaccttcaaagccttcactttggcttcgctcaaggtgactgga
cccacgaagatcgagtacgccatcggcgacaagctcgataccgccggtctgaaggttact
gccgtctatcagagtggcgacaagaccaaggaagtgccggtcgctcttgacgacccgcag
cttgcgattggctcgttcgactccaccaccgcaggcaagaaggcgattaccgtctcctac
cgtggtgtgaccgcgaccttcaacgtcacggtcaaggccaacgcagtcgcccctggccct
gaagaacagaagcccggcagcaccaacaagcccggtgccaccggcaacggcaacaagaac
acggtggccaacaccggttccaatgttgccgccatcgctggcgctgtcgctctgctggcc
gctgccgcgggtgcattgttcatgctgcgcaagcgtgcatag

DBGET integrated database retrieval system