KEGG   Brevibacterium linens BS258: A2T55_02425Help
Entry
A2T55_02425       CDS       T04319                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bly  Brevibacterium linens BS258
Brite
KEGG Orthology (KO) [BR:bly00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A2T55_02425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 UPF0767
Motif
Other DBs
NCBI-ProteinID: AMT92793
UniProt: A0A144M8P6
Position
complement(569526..571028)
Genome map
AA seq 500 aa AA seqDB search
MTQVLAPERHTPPPAVGRSNDRLWHLAFGGLLAITLIAFTLWSFDFVGRDAPRMVLITTV
IFGAFMAFNIGGNDVANAFGTSVGAGTLTMKQALLVAAIFEVSGALLAGGNVTDTVKSGI
VDLSGVAINPMDFAFIMMAALLGAAVWLLVATRMGWPVSTTHSIIGGIIGASLTIGFVTG
TGGLAMVQWSEVGQIAISWVLSPALGGLAAFVIYGLIKKYVLGKSLSHTLKPHMLAPVSA
AEGSVDAQIDVATEDAPTGEGSIGTHSALQRWVPLIAAAGAVIITAMLLFKGLKNLDMSV
STVGGLLIMAMIGAAVWLAVFVFAKTLRKQTVPRATYILFSWMQVFTASAFAFSHGSNDI
ANAVGPFAAVLDVLRTGNMHGEATVPFAAMLTCGIALIVGLWFIGRKVIATVGTNLTEIH
PASGFAAELAAAGIVMAASVSGLPVSSTHILIGAIIGVGLVNRSANWKLMKPIALAWIIT
LPAAAVIGSIGVIALRTLMG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggttctggccccggagcgccacactccgccgccggccgtcggccgcagcaac
gaccgcctctggcatctggccttcggtgggctgctggcgatcaccctcatcgccttcacc
ctgtggtccttcgacttcgtgggccgggacgctccccgcatggtgctcatcaccacggtc
atcttcggcgccttcatggcgttcaacatcggcggcaacgatgtcgccaacgccttcggc
acctcggtcggcgccggcaccctgacgatgaagcaggcgctgctcgtggccgcgatcttc
gaggtcagcggcgccctgctggccggcgggaatgtcaccgacacggtcaagagcggcatc
gtcgacctcagcggggtggcgatcaatccgatggacttcgcgttcatcatgatggcggcc
ctcctcggcgccgcggtgtggctgctcgtggcgactcggatgggctggccggtgtcgacg
acgcactcgatcatcggcggcatcatcggcgcatctctgacgatcggcttcgtcaccggc
actggcggactcgccatggtgcagtggtccgaggtcggtcagatcgcgatctcctgggtg
ctgtcccccgccctcggcggactcgccgcgttcgtcatctacgggctgatcaagaagtat
gtgctcggcaagtcgctgtcgcacacgctgaagccgcacatgctcgccccggtctccgcg
gccgagggatccgtcgacgcgcagatcgacgtcgccaccgaggatgcccccaccggcgaa
ggatcgatcggcacccattcggctctgcagcggtgggttcccctcatcgccgccgcaggt
gcggtcatcatcaccgcgatgctgctgttcaagggtctgaagaacctcgacatgagcgtg
tccaccgtcggcggcctgctcatcatggcgatgatcggcgcggccgtgtggctggcagtg
ttcgtcttcgccaagaccctgcgcaagcagacggttccccgtgcgacatacatcctgttc
tcctggatgcaggtgttcacggcctccgcattcgccttcagccacggttcgaacgacatc
gccaacgccgtcggccccttcgccgccgtcctcgatgtgctccgcaccggcaacatgcac
ggcgaggcgaccgtgccgttcgcggccatgctcacctgcggcatcgccctcatcgtcggt
ctctggttcatcggccgcaaggtcatcgcgaccgtcggcacgaacctcaccgagatccac
ccggcttccggattcgccgccgagctcgctgccgcgggaatcgtcatggccgcctcggtg
agtggtctgccggtgtcgtcgacgcacatcctcatcggtgcgatcatcggtgtcggcctg
gtcaaccgctcggcgaactggaagctcatgaagccgatcgcgctggcgtggatcatcacc
ctcccggccgccgcggtcatcggttcgatcggcgtcatcgccctgcgcaccctgatgggc
tga

DBGET integrated database retrieval system