KEGG   Brevibacterium linens BS258: A2T55_09155Help
Entry
A2T55_09155       CDS       T04319                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bly  Brevibacterium linens BS258
Pathway
bly00330  Arginine and proline metabolism
bly00360  Phenylalanine metabolism
bly00380  Tryptophan metabolism
bly00627  Aminobenzoate degradation
bly00643  Styrene degradation
bly01100  Metabolic pathways
bly01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bly00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    A2T55_09155
   00360 Phenylalanine metabolism
    A2T55_09155
   00380 Tryptophan metabolism
    A2T55_09155
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A2T55_09155
   00643 Styrene degradation
    A2T55_09155
Enzymes [BR:bly01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     A2T55_09155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AMT93921
UniProt: A0A142NPI5
Position
complement(2048986..2050419)
Genome map
AA seq 477 aa AA seqDB search
MSDEMLWWSTRELAARIASKEVSAREALQVHLDRIDEVNPVLNAVVTRDDEAAFAQAAAA
DAATARGESFGPLHGVPMTHKDTHDTAGMRTTWGSPLMGDRVPEADSLIIARLKVAGITT
TGKTNVPEFAAGSHTFNEVFGTTVNPYDRTKSASGSSGGVGAALAAGIQASGDGSDMGGS
LRSPASFNNVVGLRPSNGRIPHVPPGNPFAWLSQSGFMARTVADVALLMSVASGPHVSAP
GSILEASGVFDLPEFALDVDRSPDLTGLRVGFSPDLGGLLPVETEVKEIVAAAAQVFGNL
GAHVDDEIPNLTDADEVFNVRRALDFVGSWGGLYEAHPDKIKESVRWNIRMGLELTGAEV
ASAEAARTRLHGEIDRFFAGHDVLVLTSCQVLPFDADIEYPTQINGVRLENYLDWMRALC
LISATGCPAISVPAGFSESGLPVGLQIVAKPGADVELLRAAHAFEAATGHHERHPEL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgagatgctgtggtggtcgacgcgcgaactggctgcccggatcgcgtccaaa
gaggtctcggcccgagaggcgctgcaggtccacctcgaccgcatcgatgaggtgaatcct
gttctcaacgccgtcgtcacccgtgacgacgaagccgccttcgcccaggccgcagccgcc
gacgccgcgaccgcgcgcggtgagagcttcgggcctctgcatggagtgccgatgacccat
aaggacactcacgatactgcggggatgcgcaccacctggggttcgccgctcatgggcgat
cgggtgcccgaagcggattcactcatcatcgcccgcctcaaggtggccgggatcacgacg
acgggcaagacgaatgtgcccgaattcgccgccggttcgcacaccttcaacgaggtgttc
ggcacaacggtgaacccctatgaccggacgaaatcggcatcgggatcctccggtggagtc
ggggcggcgctcgccgcagggatccaggcatccggagacggatcggatatgggcggatct
ctgcgttcgccggcatcgttcaacaatgtcgtcggactgcggccgagcaacggccgcatc
ccacacgtgcccccaggcaatccctttgcgtggctgtcgcagagcgggttcatggctcgc
acggttgccgacgttgcactgctgatgtcggtggcctccggaccgcatgtctcggcgccg
ggttcgatcctcgaggcgagcggagtcttcgacctgccggaattcgcactcgacgtcgac
cgctcccccgacctcactggtctgcgagtcgggttcagtcccgatctcggcggactgctg
ccggtcgagaccgaggtgaaggagatcgtcgcagccgctgcgcaggtgttcggcaacctc
ggtgcccacgtggacgacgagattccgaacctcaccgacgccgatgaggtattcaacgtc
cgccgagcacttgacttcgtgggctcctggggcgggctgtatgaggcacacccggacaag
atcaaggaatcggtgagatggaacatccgcatgggccttgaactcaccggtgctgaggtg
gcctcggcagaagccgcacgcactcgcctccacggtgagatcgaccgctttttcgccggc
cacgacgtcctcgtgctcacgagctgccaggtcctgccgttcgatgcggatatcgaatat
ccgacgcagatcaacggagtgcggctggagaactacctcgattggatgcgggcgctgtgc
ctgatctcggcgaccggatgccccgcgatctcggtgccggccgggttctcggaatccggc
ctgcccgtagggctccagatcgtggcgaaaccgggtgccgatgtcgagctgctccgtgcc
gcccatgccttcgaagcagcgaccggtcaccacgagcggcaccctgagctctga

DBGET integrated database retrieval system