KEGG   Brevibacterium linens BS258: A2T55_11570Help
Entry
A2T55_11570       CDS       T04319                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bly  Brevibacterium linens BS258
Pathway
bly00620  Pyruvate metabolism
bly00630  Glyoxylate and dicarboxylate metabolism
bly01100  Metabolic pathways
bly01110  Biosynthesis of secondary metabolites
bly01120  Microbial metabolism in diverse environments
bly01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A2T55_11570
   00630 Glyoxylate and dicarboxylate metabolism
    A2T55_11570
Enzymes [BR:bly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     A2T55_11570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AMT94337
UniProt: A0A0B9AST5
Position
complement(2620315..2621919)
Genome map
AA seq 534 aa AA seqDB search
MTAHIENLDIPAGMEITGELPDGAEKVLTPKALELIVELHRKFNGDRLERLDARKKRQAE
IASGKDLDFLPETAEIRNDPSWQVAPPAPGLEDRRVEVTGPTYKKMTINALNSGAKVWLA
DQEDANTPQWDSVIQGQINLLDSLNREIDFTSPEGKEYKLAPDEELPTIVVRPRGWHMPE
KHILIDGEETSGSLVDFALYFATAGQIQIEKGRGPYFYLAKMESHLEARLWNQVFEHAED
AFGLSRGTIRATVLIETYPAAFEMEEILYELREHSAGLNAGRWDYIFSVIKYYRSRGSEF
LLPDRSDVTMTVPFMNAYTELLARTCHKRGAHAIGGMSAFVPSKDEAANKAAFDKVREDK
SREAGKGFDGSWVAHPGMVSLCKEVFTETLGDKPNQIENKREDVNVTAVDLLDVKSTPGS
MTEAGLRTNVSVGIQYLRAWLEGNGAVAINGLMEDAATAEISRSQVWQWLDAGITLDSGE
KVTKELVERIVAEEVAKLPGDDAGWKDATDTFVSVALDPEYVDFLTLPAYARMP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcatatcgaaaacctggacatccccgccgggatggagatcaccggtgagctg
ccggacggggctgagaaggtcctcacgcccaaggcgcttgagctcatcgtcgaactgcac
cggaagttcaacggcgaccgccttgaacgcctcgatgctcgcaagaagcgtcaggccgag
atcgcctcaggcaaggacctcgacttcctccccgagaccgccgagatccgcaacgatccc
tcctggcaggtcgcacctccggcacccggcctcgaagaccgccgcgtcgaggtcaccggc
ccgacctacaagaagatgacgatcaacgcgctcaactccggcgcaaaggtgtggctggcc
gatcaggaagacgcgaacaccccgcagtgggactcggttatccagggccagatcaacctg
ctcgactcgctcaaccgcgaaatcgacttcacctcgcccgagggcaaagaatacaagctc
gcccccgacgaggagctgccgactatcgtcgtgcgcccccgcggctggcacatgcccgag
aagcacatcctcatcgacggtgaggagacctccggttcgctcgtcgacttcgcgctctac
ttcgcgaccgccggccagatccagatcgagaagggccgcggcccctacttctacctcgcg
aagatggagtcccacctcgaggctcgcctgtggaaccaggtcttcgaacacgccgaggat
gccttcggcctgtcccgcggcaccatccgcgccaccgtgctcatcgagacctaccccgcg
gcgttcgagatggaagagatcctctacgagctgcgcgagcactcggctggcctcaacgcc
ggacgctgggactacatcttctccgtcatcaagtactaccgctcccgcggctccgagttc
ctgctgccggaccgctcggacgtgacgatgaccgtgccgttcatgaacgcctacaccgaa
ctgctcgcacgcacctgccacaagcgcggcgctcatgccatcggcggaatgtccgctttc
gtcccctcgaaggacgaagctgcgaacaaggccgccttcgacaaggtccgtgaggacaag
tcgcgtgaggcaggcaagggcttcgacggctcctgggtcgctcaccccggaatggtctcc
ctgtgcaaggaggtcttcacggagaccctcggcgacaagcccaaccagatcgagaacaag
cgcgaggacgtcaacgtcaccgccgtcgatctcctcgacgtgaagtcgacccccggttcg
atgacagaggccggcctgcgtaccaacgtgtccgtcggcatccagtacctgcgcgcctgg
ctcgaaggcaacggcgcggtcgccatcaacggactcatggaggacgccgcgaccgccgag
atctcccgctcccaggtgtggcagtggctcgacgccggaatcactctcgactccggtgag
aaggtgacgaaggagctcgtcgagcgcatcgtcgccgaggaggtcgccaagctgcccggt
gacgacgcaggctggaaggacgccaccgacacgttcgtctcggtcgccctcgaccccgag
tacgtcgacttcctcaccctgccggcctacgcccgcatgccgtga

DBGET integrated database retrieval system