KEGG   Burkholderia mallei ATCC 23344: BMA0106Help
Entry
BMA0106           CDS       T00204                                 

Definition
(RefSeq) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00730  Thiamine metabolism
bma00790  Folate biosynthesis
bma01100  Metabolic pathways
bma02020  Two-component system
Module
bma_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BMA0106
   00790 Folate biosynthesis
    BMA0106
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMA0106
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bma04147]
    BMA0106
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bma00537]
    BMA0106
Enzymes [BR:bma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BMA0106
Exosome [BR:bma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMA0106
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bma00537]
 Enzymes
  BMA0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Sulfatase Metalloenzyme DUF2293 TrbH
Motif
Other DBs
NCBI-GeneID: 3090565
NCBI-ProteinID: YP_101951
UniProt: A0A0H2WGP4
Position
1:complement(119254..120657)
Genome map
AA seq 467 aa AA seqDB search
MSTIKRIAAAAFAAAALSGGFGHAAHAAGQAKNVIFFLGDGMGPATVTASRLYKVGEASQ
LTMEKLPRTARIKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSMSPDTRAIAPGSDANGN
KTVNRCGVGNGTPAATLLELAKARGKAVGAITTTELTHATPAATYSHICHRDAQYDIAAQ
AVPGGAGYNAALGDGVDVLMGGGRNHWTPYDPLANRRGRADGRNLLAELQAKGYAVVATK
DQLAQAGAGKLIGLFSTTSHLEYELDRVAGKGEGATQPSLAEMTAKAIDVLRKNPNGYFL
MVEGGRIDHALHGTNAKRALEDTVAFDEAIRTALAKVDLSDTLIVVTADHDHTMTINGYS
KRGNPVLDISRNYRDGQPNKDADGNPYTTLVFGNGANRPNVRVPVDSSTATNDAYLQEVG
VRMGSAGSETHGGGDVMLFADGAGAKAFKGTLDNTKVFGLVKAAFGF
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactatcaagcgcatcgcggcggcggcgttcgccgcggcggccctctcgggcggt
ttcggccacgcggcgcacgccgcgggccaggcgaagaacgtgatcttcttcctcggcgac
gggatggggccggccaccgtgacggcgagccgcctctacaaggtcggcgaagccagccaa
ctgacgatggaaaagctgccgcgcaccgcgcgcatcaagaccttctcgaacgacgcgcag
acgacggacagcgcgccgtcgatggccgcgtacatgaccggcgtgaagatgaacaacgag
gtgctgtcgatgtcgccggacacgcgcgcgatcgcccccggcagcgacgcgaacggcaac
aagacggtgaaccgctgcggcgtgggcaacggcacgccggcggcgacgctgctcgagctc
gcgaaggcgcgcggcaaggcggtcggcgcgatcacgacgaccgagctcacgcacgcgacg
cccgcggcgacctactcgcacatctgccatcgcgacgcgcagtacgacattgccgcgcag
gccgtgccgggcggcgcgggctacaacgcggcgctcggcgacggcgtcgacgtgctgatg
ggcggcggccgcaatcactggacgccgtacgatccgctcgccaacaggcgcggccgcgcg
gatgggcgcaacctgctcgccgagctgcaggcgaagggctacgcggtggtcgcgacgaag
gatcagctcgcgcaggcgggcgcgggcaagctgatcggccttttcagcacgacgagccat
ctcgaatacgagctcgaccgcgtcgcgggcaagggcgagggcgcgacgcagccgagcctc
gcggagatgaccgcgaaggcgatcgacgtgttgcggaagaatccgaacggctatttcctg
atggtcgaaggcgggcgcatcgaccacgcgctgcacggcacgaacgcgaagcgcgcgctc
gaagacacggtggcgttcgacgaggcgatccgcaccgcgctcgcgaaggtcgatctgtcg
gatacgctgatcgtcgtgacggccgatcacgatcacacgatgacgatcaacggctattcg
aagcgcggcaatccggtgctcgacatcagccgcaactatcgcgacggccagccgaacaag
gacgcggacggcaacccgtacacgacgctcgtgttcggcaatggcgcgaaccggccgaac
gtgcgcgtgccggtggattcgtcgacggcgacgaacgacgcgtatctgcaggaagtcggc
gtgcgcatgggcagcgcgggttccgagacgcacggcggcggcgacgtgatgctgtttgcc
gacggcgccggcgcgaaggcgttcaagggcacgctcgacaacacgaaggtgttcggcctc
gtgaaggccgcgttcgggttctga

DBGET integrated database retrieval system