KEGG   Burkholderia mallei ATCC 23344: BMA0137Help
Entry
BMA0137           CDS       T00204                                 

Definition
(RefSeq) glyoxylate reductase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00260  Glycine, serine and threonine metabolism
bma00680  Methane metabolism
bma01100  Metabolic pathways
bma01120  Microbial metabolism in diverse environments
bma01130  Biosynthesis of antibiotics
bma01200  Carbon metabolism
bma01230  Biosynthesis of amino acids
Module
bma_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:bma00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BMA0137
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMA0137
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bma04147]
    BMA0137
Enzymes [BR:bma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     BMA0137
    1.1.1.399  2-oxoglutarate reductase
     BMA0137
Exosome [BR:bma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMA0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh IlvN NAD_binding_2 AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 3089351
NCBI-ProteinID: YP_101977
UniProt: A0A0H2WGR7
Position
1:complement(145714..146730)
Genome map
AA seq 338 aa AA seqDB search
MKIAILDDYQDAVRKLNCFEMLADHEVKIFNNTVRGLGQLASRLAEVEALVLIRERTHIT
SQLLGKLPHLRMISQTGRVSTHIDLEACTERGIAVLEGTGSPTAPAELTWALIMAAQRRI
PQYVANLKQGAWQQSGLKTSAMPPNFGLGQVLRGQTLGIWGYGKVGRLVAGYGKAFGMNV
LIWGREHSLEAARADGFEAAESREAFFEQADVLSLHLRLHDDTRGIVKLDDLLRMKPTSL
LVNTSRAELLEENALVSALAHNRPGMVAIDVYESEPILQGYSLLRMENVICTPHIGYVER
ESYELYFSAAFRNILAFDAGDLSSVANPDALTQGRVRR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgccatcctcgacgactaccaggacgccgtccgcaagctcaattgcttcgag
atgctcgccgaccatgaagtgaagatcttcaacaacacggtgcgcggcctcgggcaactc
gcgagccgcctggcggaagtcgaagcgctcgtgctgattcgcgagcgcacccacatcacg
tcgcaactgctcggcaagctcccgcacctgcgcatgatcagccagacgggccgcgtgtcg
acccacatcgacctcgaagcatgcacggagcgcggcatcgcggtgctcgagggcacgggc
tcgccgaccgcgcccgcggagctgacctgggcgctcatcatggccgcgcagcgccgcatc
ccgcagtacgtcgccaacctaaagcagggcgcgtggcagcagtcgggcctcaagacatcg
gccatgccgccgaacttcgggctcggccaggtgctgcgcgggcagacgctcggcatctgg
ggctacggcaaggtcggccggctcgtcgccggctacggcaaggcgttcgggatgaacgtg
ctgatctggggccgcgagcattcgctcgaagcggcgcgcgccgacggcttcgaggccgcc
gagagccgcgaggcgttcttcgagcaggccgacgtgctgtcgctgcacctgcgcctgcac
gacgacacgcgcggcatcgtcaagctcgacgacctgctgcgcatgaagccgacatcgctc
ctcgtcaacacgagccgcgcggaactgctcgaagaaaacgcgctcgtttcggcgcttgcg
cacaaccggccagggatggtcgcgatcgacgtctacgagagcgagccgatcctgcaaggc
tacagcctgctgcggatggagaacgtgatctgcacgccgcacatcggctacgtcgaacgc
gaaagctacgagctctacttcagcgcggcgttcaggaacatcctcgcgttcgatgcgggc
gacctgtcgagcgtcgcgaatcccgacgcgctcacccaggggcgcgttcgccgctga

DBGET integrated database retrieval system