KEGG   Burkholderia mallei ATCC 23344: BMA0513Help
Entry
BMA0513           CDS       T00204                                 

Definition
(RefSeq) 2-hydroxyacid dehydrogenase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00030  Pentose phosphate pathway
bma00260  Glycine, serine and threonine metabolism
bma00620  Pyruvate metabolism
bma00630  Glyoxylate and dicarboxylate metabolism
bma01100  Metabolic pathways
bma01110  Biosynthesis of secondary metabolites
bma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMA0513
   00620 Pyruvate metabolism
    BMA0513
   00630 Glyoxylate and dicarboxylate metabolism
    BMA0513
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMA0513
Enzymes [BR:bma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     BMA0513
    1.1.1.81  hydroxypyruvate reductase
     BMA0513
    1.1.1.215  gluconate 2-dehydrogenase
     BMA0513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored IlvN XdhC_C TrkA_N
Motif
Other DBs
NCBI-GeneID: 3088753
NCBI-ProteinID: YP_102310
Position
1:539086..540075
Genome map
AA seq 329 aa AA seqDB search
MQKILVARPIFPDVIERLKQYFDVDWNDGDALAPDALKARLADKDGALTAGDMIDASVLA
AAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRITESE
HWLRAGQWRKWSYDSFLGADIHGATLGVLGMGRIGQALARRARGFGMRVIYHNRSRVAPE
IEAALNAEYVPKAALLAQADHVVLVLPYSAQSHHTIGAAELALMKPSATLTNIARGGIVD
DAALADALREKRIAAAGLDVFEGEPSVHPALLDVPNVVLTPHIASASEGTRRAMANLAAD
NLIAALGAGPRAGRPPNPINPGVLGKARI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaatcctggtcgcgcgcccgatctttccggacgtgatcgagcggctcaagcag
tatttcgacgtcgactggaacgacggcgacgcgctcgcccccgatgcgctgaaggcgcgc
ctcgcggacaaggacggcgcgctgacggcgggcgacatgatcgacgcgtcggtgctcgcg
gccgcgccgcggctgcgcgtcgtgtcgaacatggcggtcggctacaacaacttcgacatc
ggcgcgttcgacgccgcgcacgtgctcggcaccaacacgcccgacgtgctgaccgagacg
acggccgatttcggctgggcgctgatgatggcggccgcgcggcggatcaccgaatccgag
cactggctgcgcgcggggcaatggcgcaagtggtcgtacgacagctttctcggcgcggac
attcacggcgcgacgctcggcgtgctcggcatgggccgcatcggccaggcgctcgcgcgc
cgcgcgcgcggcttcggcatgcgcgtgatctatcacaaccgctcgcgcgtcgcgcccgag
atcgaggccgcgctcaacgccgaatacgtgccgaaggcggcgctgctcgcgcaagccgat
cacgtcgtgctcgtgctgccgtactcggcgcaaagtcatcacacgatcggcgcggccgag
ctcgcgctgatgaagccgagcgcgacgctcacgaacatcgcgcgcggcgggatcgtcgac
gacgcggcgctcgccgacgcgctgcgcgagaagcggatcgcggcggcgggcctcgacgtg
ttcgaaggcgagccgagcgtgcatccggcgctgctcgacgtgccgaacgtcgtgctgacg
ccgcacatcgcgagcgcgagcgaaggcacgcgccgcgcgatggcgaatctcgcggcggac
aacctgatcgcggcgctcggcgcgggcccgcgcgcgggccgcccgccgaatccgatcaat
cccggcgtgctggggaaggctcgcatatga

DBGET integrated database retrieval system