KEGG   Burkholderia mallei ATCC 23344: BMA0718Help
Entry
BMA0718           CDS       T00204                                 

Gene name
argH
Definition
(RefSeq) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00220  Arginine biosynthesis
bma00250  Alanine, aspartate and glutamate metabolism
bma01100  Metabolic pathways
bma01110  Biosynthesis of secondary metabolites
bma01130  Biosynthesis of antibiotics
bma01230  Biosynthesis of amino acids
Module
bma_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMA0718 (argH)
   00220 Arginine biosynthesis
    BMA0718 (argH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bma04147]
    BMA0718 (argH)
Enzymes [BR:bma01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     BMA0718 (argH)
Exosome [BR:bma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMA0718 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2
Motif
Other DBs
NCBI-GeneID: 3090986
NCBI-ProteinID: YP_102488
UniProt: Q62LD1
Position
1:complement(744087..745496)
Genome map
AA seq 469 aa AA seqDB search
MTSQLHKKGEAWSARFSEPMSELVKRYTSSVFFDKRLALVDIAGSLAHAGMLAAQKIISA
DDLAAIERGMAQIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQV
ATDIRLWLRGEIDRIGGLLNDLRGALIDLAEQNADTILPGFTHLQVAQPVTFGHHLLAYV
EMFSRDAERMRDCRARVNRLPLGAAALAGTSYPIDRHAVAKTLGFDGICANSLDAVSDRD
FAIEFTAAAALVMTHVSRFSEELVLWMSPRVGFIDIADRFCTGSSIMPQKKNPDVPELAR
GKTGRVNGHLMALLTLMKGQPLAYNKDNQEDKEPLFDTVDTVADTLRIFAEMVAGITVKP
DAMRAAALQGFSTATDLADYLVKRGLPFRDAHEAVAHAVKVCDARGIDLADLTLDEMKQE
LPNVAHLIGEDVFDYLTLEGSVASRNHPGGTAPDQVRAAAKAARAALGQ
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcccaactgcacaaaaagggcgaggcctggtcggcccgcttttcggaaccgatg
tccgagctcgtcaagcgctacacgtcgtcggtcttcttcgacaagcggctcgcgctcgtc
gacatcgccggctcgctcgcgcacgcaggcatgctcgccgcgcagaagatcatcagcgcc
gacgacctcgccgcgatcgagcgcgggatggcgcaaatcaagggcgagatcgagcgcggc
gaattcgaatggcagctcgatctcgaagacgtccacctgaacatcgaggcgcgcctgacc
gcgctcatcggcgatgcgggcaagcgcctgcacacgggccgctcgcgcaacgatcaggtc
gcgaccgacatccgcctgtggctgcgcggcgagatcgaccggatcggcggcctgctgaac
gacctgcgcggcgcgctgatcgatctcgccgaacagaacgcggacacgatcctgccgggc
ttcacgcacctgcaggtcgcgcagcctgtcacgttcggccatcacctgcttgcctacgtc
gagatgttctcgcgcgacgccgagcgcatgcgcgactgccgcgcgcgcgtgaaccgcctg
ccgctcggcgcggcggcgctcgcgggcaccagctatccgatcgaccgccacgcggtggcg
aagacgctcggcttcgacggcatctgcgcgaactcgctcgacgcggtgtccgatcgcgac
ttcgcgatcgaattcacggccgcggccgcgctcgtgatgacgcacgtgtcgcgcttctcg
gaagaactcgtgctgtggatgagcccgcgcgtgggcttcatcgacatcgccgaccgcttc
tgcaccggcagctcgatcatgccgcagaagaagaacccggacgtgcccgagctcgcgcgc
ggcaagacgggccgcgtaaacggccacctgatggcgctgctcacgctgatgaagggccag
ccgctcgcgtacaacaaggacaatcaggaagacaaggaaccgctgttcgacacggtcgac
accgtcgccgacacgctgcggatcttcgcggagatggtcgcgggcatcacggtgaagccg
gacgcgatgcgcgcggccgcgctgcagggcttctcgaccgcgacggatctcgcggactac
ctggtcaagcgcgggttgccgttccgcgacgcgcacgaggcggtcgcgcacgcggtgaag
gtctgcgacgcgcgcggcatcgacctcgcggatctgacgctcgacgaaatgaagcaggaa
ctgccgaacgtcgcgcatctgatcggcgaggacgtgttcgactatctgacgctcgaaggc
tcggtcgcgagccgcaatcatccgggcggcaccgcgccggaccaggtgcgcgcggcggcg
aaggccgcgcgcgcggcgctcggccagtaa

DBGET integrated database retrieval system