KEGG   Burkholderia mallei ATCC 23344: BMA0778Help
Entry
BMA0778           CDS       T00204                                 

Gene name
folP
Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00790  Folate biosynthesis
bma01100  Metabolic pathways
Module
bma_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMA0778 (folP)
Enzymes [BR:bma01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BMA0778 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-GeneID: 3089554
NCBI-ProteinID: YP_102541
UniProt: A0A0H2WKI4
Position
1:811763..812653
Genome map
AA seq 296 aa AA seqDB search
MSSSDSVFPVPAPLQCGRFTLTFERPLVMGILNVTPDSFSDGGRYVARDAALAQAERMLA
EGADILDIGGESTRPGAPPVPLNEELERVIPLVEALRGRNVPLSIDTYKPAVMRASLAAG
ADLINDIWGLRQPGAIDAVRDSACGLCVMHMLGEPRTMQVHAPEYRDVIDDVRAFLAERA
DALVQAGVDARRISVDPGFGFGKSVIEHNYALLAHLPRTAPARPDGRAYPILAGMSRKSM
LGAVIGRPAPERIAASVAAAVCAAERGAAIVRVHDVAATVDALKVWSAVRDAARRA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagttccgattccgtttttcccgttcccgcgccgctgcaatgcggccgtttcacc
ttgaccttcgagcgccccctcgtgatggggatcctcaacgtcacccccgattcgttctcc
gacggcggccgttacgtcgcccgtgacgccgcgctcgcgcaggcggagcggatgcttgcc
gaaggcgcggacatcctcgacatcggcggcgaatcgacgcgccccggcgcgccgcccgtg
ccgcttaacgaggagctcgagcgcgtgattccgctcgtcgaggcgctgcgcggccggaac
gtgccgctgtcgatcgacacgtacaagcccgccgtgatgcgcgcgtcgctcgccgcgggc
gccgatctgatcaacgatatctgggggctgcggcagccgggcgcgatcgacgcggtgcgc
gacagcgcgtgcggcctctgcgtgatgcacatgctcggcgagccgcggacgatgcaggtg
catgcgcccgagtatcgcgacgtgatcgacgacgtgcgcgcgtttctcgccgagcgcgcc
gatgcgctcgtccaggcgggcgtcgatgcccggcgtatcagcgtcgatccggggttcggt
ttcggcaagtcggtgatagaacacaactatgcgctgcttgcgcatttgccgaggaccgcg
cccgcgcggcccgacgggcgcgcgtatccgatcctcgccggcatgtcgcgcaagtcgatg
ctgggcgcggtgatcggcagacccgcgcccgagcgcatcgcggcgagcgtcgcggcggcg
gtctgcgcggccgagcggggggcggcgatcgtgcgcgtgcacgacgtcgcggcgaccgtc
gacgcattgaaagtatggagcgccgtgcgcgatgccgcgcggcgagcataa

DBGET integrated database retrieval system