KEGG   Burkholderia mallei ATCC 23344: BMA0855
Entry
BMA0855           CDS       T00204                                 

Definition
(RefSeq) Rhs element Vgr protein
Organism
bma  Burkholderia mallei ATCC 23344
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V
Other DBs
NCBI-GeneID: 3090562
NCBI-ProteinID: YP_102595
UniProt: A0A0H2WIR0
Position
1:893967..896774
AA seq 935 aa
MSVITQFTSLFSAANCLYCLDGPGEIASLQIERWVGRETLSENFQWDVYALATDPGLDLD
AMLGQRVTIRTALANGTSAVRSGLVAQAECIGYDAGLARYCLQLVPWLAALAHGRDERTF
VRQGVADVLGAVFAPYGAIARWRFTADANQRIAELGARDYRVQYRTHTHFDFVRHVLAEA
GLGFCFVEEADAPAGHTMLIFDDSTQLPEDETSARMGGVPQRLSGTATEPDDVIVGIGQS
LSLTADRVTLISSDYRGNQSTSATASLGNPAGSRELYDDVGPEAFDSLREADAAARRHAD
AIVSAARFWTGYGTLRTARAGRALRIAGATWRMSRGGAPAPDAFVLTRVDQIGINNLPAT
VMERVERSLGPLPPANLDARVLAQAKAGGYANRFDAAPRDQAWRPTLEDGTGQRLNPVPT
ALGAQTAIVVGPQGETRPGSTGPVHTDAQGRLRLRYHWQADGDAGTYPTRAMQRLASEGH
GLQQTPRIGHEVLVQFVNGLVHRPIVLGGLFNGRGEGGEAPTLGGEAGQPLDESVYAQAS
DHAASAQGNLAGGHSPAWHGAGGGAKRHDHAGALSGFKSQEFDGQGYNQLVADDTDRMGR
MQMATTHAATQLNIGHLRHQADNYLGSFRGQGVELRSDAYGALRGARGVLISSYAPTGPS
QPAGDASALQSLLAQQAALAKLLDKSADTHKTLPFAAQRGAQRAGQSSMNGDAAPLDALG
KSFATTVGADGYAQASADASRRATDNALPHTGDAVLGVEAKGGQGLLAGQSLQWAAGETL
TIGSGNDTNLAVNRTLRVHSGQGIGWLAGANGANGAQGVGMSVIAGKDDLALQAQHDLMA
LRARDDLRVASIGADVEIAAKQTVRLAVSGGAHLTIEGGNVTFGCPGSLVVHAAQHTFVG
PDQLAPALPQFPEKVCVECLKHAMQSGSALAGKAI
NT seq 2808 nt   +upstreamnt  +downstreamnt
atgagcgtgatcacgcaattcacgtcgcttttcagcgctgccaattgtctctattgtctc
gacggtccgggcgaaatcgcgtcgctgcagatcgagcgctgggtggggcgggagacgctc
tccgagaacttccagtgggatgtctacgcgctcgcgaccgatcccggcctcgacctcgac
gcgatgctcgggcagcgcgtgacgatccgcacggcgctcgcgaacggcacgagcgccgtg
cgcagcgggctcgtggcgcaggccgagtgcatcggctacgacgccggcctcgcgcgctac
tgcctgcagctcgtgccgtggctcgccgcgctcgcgcacggccgcgacgagcgcacgttc
gtgcggcagggcgtcgccgacgtgctcggcgcggtgttcgcgccgtacggcgcgatcgcc
cgctggcgcttcaccgcggacgcgaaccagcgcatcgcggaactcggcgcgcgcgactac
cgcgtgcagtaccgcacccacacgcatttcgatttcgtccggcacgtgcttgccgaagcg
ggtctcggcttttgcttcgtcgaggaggcggacgcgcccgcgggccacacgatgctgatc
ttcgacgacagcacgcagttgcccgaggacgagacttccgcgcgcatgggcggcgtgccg
cagcggctgagcggcacggcgaccgagccggacgacgtgatcgtcggcatcgggcagtcg
ctgtcgctgaccgcggatcgcgtcacgctgatcagcagcgactaccgcggcaaccagtcg
acgagcgcgacggcgagcctcggcaatccggccggatcgcgcgagctgtacgacgacgtc
gggccggaggcgttcgacagcctgcgcgaggccgacgccgccgcgcggcggcacgcggac
gcgatcgtctcggcggcgcgcttctggacaggctacggcacgttgcgcaccgcgcgcgct
ggccgcgcgctgcgcatcgcgggcgcgacgtggcgcatgtcgcgcggcggcgcgccggcg
cccgatgcgttcgtgttgacgcgcgtcgatcagatcggcatcaacaatttgcccgcgacg
gtgatggagcgcgtcgagcgcagcctcggcccgctgccgcccgcgaatctcgacgcgcgc
gtgctcgcgcaggcgaaggcgggcggctatgcgaaccggttcgacgccgcgccgcgcgac
caggcatggcgcccgacgctggaggacggcaccggccagcgactgaacccggtgccgacg
gcgctcggcgcgcagacggcgatcgtcgtcgggccgcagggcgagacgcggccgggctcg
acgggcccggtgcataccgacgcgcagggccggttgcggctgcgctatcactggcaggcg
gacggcgacgcgggcacctatccgacgcgcgcgatgcagcggctcgcgagcgaggggcac
gggctgcagcagacgccgcggatcggccacgaggtgctcgtgcagttcgtcaacggcctc
gtgcaccggccgatcgtgctcggcgggctgttcaacggccgcggcgagggcggcgaagcg
ccgacgctcggcggcgaagcggggcagccgctcgacgaatcggtctacgcacaggcgagc
gaccacgcggcgagcgcgcaaggcaatcttgcgggcggccatagccccgcgtggcacggc
gcgggcggcggcgcgaagcgccacgatcacgcgggcgcgctgtccggcttcaagagccag
gagttcgacggccagggctacaaccagctcgtcgcggacgataccgatcgcatgggccgc
atgcagatggcgacgacgcacgcggcgacccagctcaatatcggccatttgcggcatcag
gccgacaactatctcggcagcttccgcgggcaaggcgtcgagctgcgctcggacgcgtac
ggcgcgctgcgcggcgcgcgcggcgtgctgatctccagctatgcgccgacggggccgtcg
cagccggcgggcgatgcgtcggcgctgcagtcgctgctcgcgcaacaggcggcgctcgcg
aagcttctcgacaaatcggcggacacgcacaagaccttgccgttcgccgcgcagcgtggc
gcgcagcgggccggacagtcgtcgatgaacggcgacgccgcgccgctcgacgcgctcggg
aagagtttcgcgacgacggtcggcgccgacggctacgcgcaggcgtcggccgacgcatcg
cgccgcgcgacggacaatgcgctgccgcataccggcgacgcggtgctcggcgtcgaggcg
aagggcggccaggggctgctggccggccagtcgctgcaatgggcggcgggcgagacgctg
accatcggcagcggcaacgacaccaacctcgcggtcaaccggacgttgcgcgtgcacagc
gggcagggcatcggctggcttgccggcgcgaacggcgcgaacggcgcgcagggcgtcggc
atgagcgtgatcgccggcaaggacgatctggcgctgcaggcgcagcacgacctgatggcg
ctgcgcgcgcgcgacgatctgagggtcgcgtcgatcggcgcggacgtcgagatcgcggcg
aagcagaccgtgcggctcgcggtcagcggcggcgcgcatctgacgatcgaaggcggcaac
gtcacgttcggctgcccgggctcgctcgtcgttcatgcggcccagcatacgttcgtcggg
ccggatcaactggctcccgcgctgccgcagtttcccgagaaggtgtgcgtcgaatgcctg
aagcacgcgatgcaatcgggcagcgcactggccggcaaggcgatctga

DBGET integrated database retrieval system