KEGG   Burkholderia mallei ATCC 23344: BMA1398Help
Entry
BMA1398           CDS       T00204                                 

Definition
(RefSeq) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bma  Burkholderia mallei ATCC 23344
Brite
KEGG Orthology (KO) [BR:bma00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BMA1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-GeneID: 3089027
NCBI-ProteinID: YP_103054
UniProt: A0A0H2WFY5
Position
1:complement(1457810..1458820)
Genome map
AA seq 336 aa AA seqDB search
MHSIQLALWVVAALVLVALVFDFMNGFHDAANSIATVVSTGVLKPQQAVVFAAAFNVIAY
FIFHLKVAQTVGKGTIDASIVDHYVVFGALFGAIGWNIITWYYGIPSSSSHALIGGLVGA
AVSKSGWGSLNVDGLMKTVAFIFISPLLGFILGSLFMLGVSWLYFRTAPSKVDRRFRRLQ
LLSASLYSLGHGGNDAQKTIGIIWMLLIASGYASAASDAPPAWVIGACYLSMGLGTLFGG
WRIVRTMGQKITKLKPVGGFCAETGGALTLFIASWMGIPVSTTHTITGAIVGVGATRKLS
AVRWGVAGNIVWAWVLTIPASALIAAAGWWIGHRVF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgatacaactcgccttgtgggtggtcgcggcgctcgtgctcgtcgcgctcgtg
ttcgatttcatgaacggttttcacgacgccgcgaactcgatcgcgaccgtcgtgtcgacc
ggggtgctcaagccccagcaagccgtcgtgttcgcggcggcgttcaacgtcatcgcgtat
ttcattttccacctgaaggtcgcgcagaccgtcggcaagggcacgatcgacgcgagcatc
gtcgatcattacgtcgtgttcggcgcgctgttcggcgcgatcggctggaacatcattacg
tggtactacgggattccgtcgagctcgtcgcacgcgctgatcggcgggctcgtcggcgcc
gcggtgtcgaaatcgggctgggggtcgctgaacgtcgacgggctgatgaagaccgtcgcg
ttcatcttcatctcgccgctgctcggcttcatcctcggctcgctgttcatgctcggcgtg
tcgtggctgtacttccgcaccgcgccgagcaaggtcgaccggcgcttcaggcggctgcaa
ctgctgtcggcgagcctgtacagcctcggccacggcggcaacgacgcgcagaagacgatc
ggcatcatctggatgctgctgatcgcatcgggctatgcatcggccgcgtccgacgcgccg
cccgcctgggtgatcggcgcatgctatctgtcgatgggcctcggcacgctgttcggcggc
tggcggatcgtgcgcacgatgggccagaagatcacgaagctcaagccggtcggcggtttc
tgcgcggaaacgggcggcgcgctcacgctgttcatcgcttcgtggatgggcattccggta
tcgaccacgcacacgatcaccggcgcgatcgtcggtgtcggcgcgacgcgcaagctgtcg
gccgtgcgctggggcgtcgcgggcaacatcgtgtgggcatgggtgctgacgattcccgcc
tcggcgctgatcgcggcggcgggctggtggatcgggcaccgggtgttctga

DBGET integrated database retrieval system