KEGG   Burkholderia mallei ATCC 23344: BMA1436Help
Entry
BMA1436           CDS       T00204                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00071  Fatty acid degradation
bma00072  Synthesis and degradation of ketone bodies
bma00280  Valine, leucine and isoleucine degradation
bma00310  Lysine degradation
bma00362  Benzoate degradation
bma00380  Tryptophan metabolism
bma00620  Pyruvate metabolism
bma00630  Glyoxylate and dicarboxylate metabolism
bma00640  Propanoate metabolism
bma00650  Butanoate metabolism
bma00900  Terpenoid backbone biosynthesis
bma01100  Metabolic pathways
bma01110  Biosynthesis of secondary metabolites
bma01120  Microbial metabolism in diverse environments
bma01130  Biosynthesis of antibiotics
bma01200  Carbon metabolism
bma01212  Fatty acid metabolism
bma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMA1436
   00630 Glyoxylate and dicarboxylate metabolism
    BMA1436
   00640 Propanoate metabolism
    BMA1436
   00650 Butanoate metabolism
    BMA1436
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMA1436
   00072 Synthesis and degradation of ketone bodies
    BMA1436
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMA1436
   00310 Lysine degradation
    BMA1436
   00380 Tryptophan metabolism
    BMA1436
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMA1436
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMA1436
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMA1436
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bma04147]
    BMA1436
Enzymes [BR:bma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMA1436
Exosome [BR:bma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMA1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 3089026
NCBI-ProteinID: YP_103088
UniProt: A0A0H2WEY5
Position
1:complement(1488582..1489760)
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTGLAKSWRGAFNMTHGATLGGHVVAAAVERAKLDPARVEDVLIGCANPE
GATGANIARQIALRAGLPVGVPGMTVNRFCSSGLQTIALAAQRVIAGEGDVFVAGGVESI
SCVQNEMNRHMLREGWLDAHKPEIYWTMLQTAENVAKRYGISKARQDEYGVNSQLRAAAA
QAAGRFNAEIVPITVRAGVADKATGRLYTKEVTLAADEGIRPDTTLEGVAKIRAALPGGV
ITAGNASQFSDGAAACVVMNAKVAEREGLAPLGIFRGFAVAGCEPDEMGIGPVYAVPKLL
KQAGLKVSDIDLWELNEAFAVQVLYCRDTLGIPDDRLNVNGGAIAVGHPYGVSGARLTGH
ALIEGKRRGAKYVVVTMCIGGGQGAAGLFEVV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtaatcgtatcgaccgcccgcaccgggctcgcgaaatcctggcgcggc
gcgttcaacatgacgcacggcgcgacgctcggcggccacgtggtcgcggcggccgtcgag
cgcgcgaagctcgatcccgcgcgcgtcgaggacgtgctgatcggctgcgcgaacccggaa
ggcgcgacgggcgcgaacatcgcgcggcagatcgcgctgcgcgcggggctgcccgtcggc
gtgccggggatgaccgtcaaccgcttctgctcgtcgggattgcagacgatcgcgctcgcc
gcgcagcgcgtgatcgcgggcgagggcgacgtgttcgtcgcgggcggcgtcgaatcgatc
tcgtgcgtgcagaacgagatgaaccgccacatgctgcgcgagggctggctcgacgcgcac
aagccggagatctactggacgatgctgcagacggccgagaacgtcgcgaagcgttacggc
atctcgaaggcgcgccaggacgagtacggcgtgaattcgcagctgcgcgcggccgccgcg
caggcggcggggcgctttaatgccgagatcgtgccgatcaccgtgcgcgcgggcgtcgcc
gacaaggcgacgggccgcctctacacgaaggaggtgacgctcgccgccgacgagggcatt
cggcccgacacgacgctcgagggcgtcgcgaagatccgcgcggcgctgccgggcggcgtg
atcaccgcgggcaacgcgagccagttctcggacggcgcggccgcgtgcgtcgtgatgaac
gcgaaggtggccgagcgcgagggcctcgcgccgctcggcattttccgcggcttcgcggtg
gccggctgcgagccggacgagatgggcatcgggcccgtctacgcggtgccgaagctgctg
aagcaggcggggctcaaggtgtccgacatcgatctgtgggaactgaacgaggcgttcgcg
gtgcaggtgctctattgccgcgacacgctcgggattcccgacgatcggctgaacgtgaac
ggcggcgcgatcgcggtcggccatccgtacggcgtatcgggcgcgcggctcaccggccac
gcgctgatcgagggcaagcggcgcggcgcgaaatacgtcgtcgtgacgatgtgcatcggc
ggcgggcagggcgcggcggggctgttcgaggtggtgtga

DBGET integrated database retrieval system