KEGG   Burkholderia mallei ATCC 23344: BMA2099Help
Entry
BMA2099           CDS       T00204                                 

Definition
(RefSeq) deoxyribonucleotide triphosphate pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:bma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BMA2099
Enzymes [BR:bma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     BMA2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like PBAN
Motif
Other DBs
NCBI-GeneID: 3088734
NCBI-ProteinID: YP_103673
UniProt: Q62HZ7
Position
1:2190516..2191148
Genome map
AA seq 210 aa AA seqDB search
MTMSHASPDAARSRIVLASNNPGKLREFAALFSTAGIDIVPQGELGVSEADEPHATFVEN
ALAKARHASRATGLPAVADDSGLCVPALLGAPGVYSARYAQRAGREKSDAANNAYLVEQL
REVADRRAYYYCVLALVRHADDPEPLIAEGRWAGEIVDAPRGAHGFGYDPHFFVPALGAT
AAELDPAAKNAASHRALALKALVARLGEIR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgtcgcacgcatcgcccgacgccgcgcgctcgcgcatcgtcctcgcctcgaac
aatcccggcaagctgcgcgagttcgccgcgctcttctcgacggcgggcatcgacatcgtg
ccgcaaggcgagctcggcgtatcggaagccgacgaaccgcacgcgaccttcgtcgagaac
gcgctcgcgaaggcacgccatgcgtcgcgcgcgacgggcctgcccgccgtcgccgacgat
tccggcctgtgcgtgcccgcgctgctcggcgcgccgggcgtctactcggcgcgctacgcg
cagcgcgccggccgcgagaagagcgatgcggcgaacaacgcgtatctcgtcgagcagttg
cgcgaggtcgcggatcggcgcgcgtattactactgcgtgctcgcgctcgtgcggcacgcg
gacgatccggagccgctcatcgccgaagggcgctgggcgggcgagatcgtcgacgcacca
cgcggcgcgcacggcttcggctacgatccgcacttcttcgtgccggcgctcggcgcgacg
gcggccgagctcgatccggccgcgaaaaacgcggcgagccatcgcgcgctcgcgctgaag
gcgctcgtcgcgcggctcggagaaattcgatga

DBGET integrated database retrieval system