KEGG   Burkholderia mallei ATCC 23344: BMA2336Help
Entry
BMA2336           CDS       T00204                                 

Definition
(RefSeq) carbon-nitrogen family hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bma  Burkholderia mallei ATCC 23344
Brite
KEGG Orthology (KO) [BR:bma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BMA2336
Enzymes [BR:bma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BMA2336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 3090737
NCBI-ProteinID: YP_103895
UniProt: A0A0H2WLN9
Position
1:2438778..2439605
Genome map
AA seq 275 aa AA seqDB search
MTDRHASASPFPVAALQMVSTPDRERNLAEAGRLIADAAASGARLVLLPEYFCFMSHQDT
DKLALAEAYRDGPIQRFLAERAKAHGIWVIGGTLPLKAPEPSRVLNTTLVFDPQGREAAR
YDKIHLFNFEKGDESFDEARTIRPGDAVRTFDAPFGRVGLSVCYDLRFPELYRRMGDCAM
IVVPSAFTYTTGRAHWETLLRARAVENQCYVLAAAQGGKHENGRRTWGRSMLVDPWGEIV
AVRDEGAGVVAGEIDPARIADVRQSLPAWRHRVLA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgccacgcctcagcctcgccgttcccggtcgccgcgctgcagatggtcagc
acgcccgatcgcgagcgcaatctcgccgaagccggccggctgatcgccgatgcggcggcc
tcgggcgcacggctcgtgctgctgcccgaatatttctgcttcatgagccaccaggacacc
gacaagctcgcgctcgcggaagcgtaccgtgacggcccgatccagcgctttctcgccgag
cgcgcgaaggcgcacggcatctgggtgatcggcggcacgctgccgctgaaggcgcccgag
ccgtcgcgcgtgctgaacacgacgctcgtgttcgatccgcaaggccgcgaggccgcccgc
tacgacaagatccatctgttcaacttcgagaagggcgacgagtcgttcgacgaggcgcgc
acgatccgcccgggcgacgcggtgcgcacgttcgacgcgccgttcggccgggtcgggctg
tcggtctgctacgatctgcgctttccggagctgtaccggcgaatgggcgactgcgcgatg
atcgtcgtgccgtcggcgttcacgtacacgacggggcgcgcgcactgggagacgctgttg
cgcgcccgcgcggtcgagaaccagtgctacgtgctcgccgccgcgcaaggcggcaagcac
gagaacggccgccgcacgtgggggcgcagcatgctcgtcgatccgtggggcgagatcgtc
gcggtgcgcgacgaaggcgcgggcgtcgtcgcgggcgagatcgatcccgcgcggatcgcc
gacgtgcggcagagcctgcccgcgtggcggcatcgcgtgctcgcgtga

DBGET integrated database retrieval system