KEGG   Burkholderia mallei ATCC 23344: BMA2601Help
Entry
BMA2601           CDS       T00204                                 

Gene name
hemB
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00860  Porphyrin and chlorophyll metabolism
bma01100  Metabolic pathways
bma01110  Biosynthesis of secondary metabolites
bma01120  Microbial metabolism in diverse environments
Module
bma_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMA2601 (hemB)
Enzymes [BR:bma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BMA2601 (hemB)
Exosome [BR:bma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMA2601 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 3088041
NCBI-ProteinID: YP_104136
UniProt: A0A0H2WGF5
Position
1:2711929..2712993
Genome map
AA seq 354 aa AA seqDB search
MSQKFTEGNCKVSSVTYPSHSAMSIHPLHRPRRMRRDDFSRRLMRENILTTNDLIYPVFV
VEGTNVRQPVPSMPGVERVSIDLLMGVAEQCVELGVPVLSLFPAIEPSLKTPDGREAANP
EGLIPRAVRELKRRFPELGVLTDVALDPYTSHGQDGVLDEAGHVLNDETLEILVEQARAQ
AEAGVDIVAPSDMMDGRIGAVREMLEREGHIYTRIMAYSAKYASAFYGPFRDAVGSASNL
GKGNKMTYQMDPANSDEALREVRLDIDEGADMVMVKPGMPYLDIVRRVKDEFRYPTYVYQ
VSGEYAMLKAAAQNGWLDHDKVVLESLLAFKRAGADGILTYFALDAARLLRAQK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
ttgtctcaaaagtttaccgaagggaactgtaaggtttcgtcggttacctatcccagccat
tccgccatgagcatccatcccctgcaccgcccgcgccgcatgcgccgcgacgatttctcg
cgacgcctgatgcgcgaaaatatcctcaccacgaacgatctgatctacccggtgttcgtc
gtcgaaggcacgaacgtgcgccagccggtgccgtcgatgccgggcgtcgagcgcgtgtcg
atcgatctgctgatgggtgtcgccgagcaatgcgtcgagctcggcgtgccggtcctgtcg
ctctttccggccatcgagccgtcgctgaagacgcccgacggccgcgaagcggccaatccc
gaagggctgatcccgcgtgcggtacgcgagctgaagcgccgcttccccgaactcggcgtg
ctgaccgacgtcgcgctcgatccgtacacgagccacggccaggacggcgtgctcgacgag
gccggccatgtgctcaacgacgaaacgctcgagattctcgtcgagcaggcgcgcgcgcag
gccgaagcgggcgtcgacatcgtcgcgccgtcggacatgatggacgggcgcatcggcgcg
gtgcgcgagatgctcgagcgtgaaggccacatctatacgcggatcatggcctactcggcg
aagtacgcgtcagcgttctacggcccgttccgcgacgcggtcggctccgcgtcgaatctc
ggcaagggcaacaagatgacctaccagatggaccccgcgaacagcgacgaggcgctgcgc
gaagtgcgcctcgacatcgacgagggcgcggacatggtcatggtgaagcccggcatgccg
tatctcgacatcgtgcgccgcgtgaaggacgaattccgctatccgacctacgtctatcag
gtgagcggcgaatacgcgatgctgaaggccgccgcgcagaacggctggctcgatcacgac
aaagtcgtgctcgaatcgctgctcgcgttcaagcgcgcgggcgcggacggcattctcacg
tacttcgcgctcgacgcggcgcggctgctgcgcgcgcagaagtaa

DBGET integrated database retrieval system