KEGG   Burkholderia mallei ATCC 23344: BMA2927Help
Entry
BMA2927           CDS       T00204                                 

Gene name
phhA
Definition
(RefSeq) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00360  Phenylalanine metabolism
bma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bma00790  Folate biosynthesis
bma01100  Metabolic pathways
bma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BMA2927 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMA2927 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMA2927 (phhA)
Enzymes [BR:bma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BMA2927 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-GeneID: 3088835
NCBI-ProteinID: YP_104434
UniProt: A0A0H2WFW3
Position
1:complement(3017125..3018135)
Genome map
AA seq 336 aa AA seqDB search
MMRNYRIYPYTIAHFAPKPREPRSTLACIPTTDAKQGYPMSTVVTAKLKEQFDAGLETRA
DFTIDQPLARYGDVDHAVWTQLYTRQAALLRGRACDAFIEGLARIGLAPDRVPSFADVNR
RLEPATGWRIVAVPGLVPDAVFFEHLANRRFPVTWWMRRPDQLDYLQEPDCFHDLFGHVP
LLIDPVFADYMHAYGRAALRVADDASALALLARLYWYTVEFGLIRDTRGENGLRIYGAGI
VSSKGETLYSLESASPNRIGFDLERVMRTRYRIDTFQKTYFVIDDFAQLFALADLDARAL
AARLAGAPEHAAGAVLDGDHVLTRGTGEGWAADADA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcgcaattatcgcatttatccatacacaatcgcccattttgcgcccaaaccgcgc
gagccccgctctacacttgcatgcatccccaccactgatgcgaagcagggctaccccatg
tccacggtcgttaccgcgaaactgaaggaacagttcgacgcgggcctcgaaacccgcgcc
gatttcaccatcgatcagccgctcgcccgctacggcgacgtcgaccacgcggtgtggacg
cagttgtatacgcggcaggcggcgctgctgcgcggccgtgcatgcgacgcgttcatcgag
ggcctcgcgcgcatcggcctcgcgcccgatcgcgtgccgtcgttcgccgacgtgaaccgg
cggctcgagcccgcaaccggctggcgcatcgtcgcggtgccgggcctcgtgccggacgcc
gttttcttcgagcatctcgcgaaccggcggtttccggtcacctggtggatgcgccgcccg
gaccagctcgattatctacaggagccggactgcttccacgatctgttcggccacgtgccg
ctgctgatcgatcccgtattcgccgactacatgcacgcatacggccgcgcggcgcttcgc
gtcgccgacgacgcaagcgcgctcgcgctccttgcgcgcctctattggtatacggtcgaa
ttcggcctgattcgcgacacgcgcggcgaaaacgggctgcggatctacggcgcgggcatc
gtgtcgagcaagggcgaaacgctctacagcctcgaaagcgcgtcgccgaaccggatcggc
ttcgatctcgaacgcgtgatgcggacccggtaccggatcgacacgttccagaagacctac
ttcgtgatcgacgatttcgcgcaactcttcgcgctcgccgacctcgacgcgcgcgcgctc
gccgcgcggctcgccggcgcgcccgagcacgcggcgggcgcggtgcttgacggcgatcat
gtgctcacgcgcggcaccggtgaaggctgggcagccgatgcagacgcttga

DBGET integrated database retrieval system