KEGG   Burkholderia mallei ATCC 23344: BMA3118Help
Entry
BMA3118           CDS       T00204                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00900  Terpenoid backbone biosynthesis
bma01100  Metabolic pathways
bma01110  Biosynthesis of secondary metabolites
bma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMA3118 (ipk)
Enzymes [BR:bma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BMA3118 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 3090198
NCBI-ProteinID: YP_104603
UniProt: Q62FC4
Position
1:3213654..3214544
Genome map
AA seq 296 aa AA seqDB search
MPSMTDTTRSLRDCLAPAKLNLFLHITGRRPDGYHALQSVFQLLDWGDRLHFTLRDDGKV
SRVTDVPGVPEESDLVVRAASLLKAHAGATLGVDIEIDKRLPMGAGLGGGSSDAATTLLA
LNRLWRLDLPRTTLQSLAVKLGADVPFFVFGKNAFAEGIGEALQAVELPARWFLVVTPRV
HVPTAAIFSEKSLTRDSKPITITDFLAQRGIDAGWPDSFGRNDMQPVVTSKYAEVAKVVE
WFYNLTPARMTGSGASVFAAFKSKADAEAAQAKLPAGWNSAVAESMSEHPLFAFAS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgcctagcatgaccgatacgacccgctcgctgcgcgactgcctcgccccggcgaaactg
aacctgttcctgcacatcacgggccgccgcccggacggctatcacgcgctgcaaagcgtg
ttccagctgctcgactggggcgaccggctgcacttcacgctgcgcgacgacggcaaggtc
tcgcgcgtgacggacgtgccgggcgtgcccgaggaatccgacctcgtcgtgcgcgccgcg
tcgctgctgaaggcgcacgccggcgcgacgctgggcgtcgacatcgagatcgacaagcgg
ctgccgatgggcgcgggcctgggcggcggcagctcggacgcggcgacgacgttgctcgcg
ctcaaccggctatggcggctcgacctgccgcgcaccacgctgcaatcgctcgcggtgaag
ctcggcgccgacgtgccgttcttcgtcttcggaaaaaatgcgttcgcggagggtatcgga
gaagcgctgcaagctgtagaattgccggctcgctggttcctggttgtgacaccgcgggtt
cacgtgccgacggcagcgattttttccgaaaaatcgttgacaagagattcgaaacccatc
acaattacggactttcttgcacagcgcggcatcgacgcaggatggccagacagcttcggc
cggaatgacatgcagccggttgtgacaagcaagtacgcggaagttgcaaaggtggtcgaa
tggttttataatctgacccccgcgcggatgaccggctctggagcgagcgtgtttgcagcg
ttcaagagcaaggctgatgcagaagcggcgcaagccaaactgcctgccggctggaacagc
gcagttgccgagagcatgagtgagcatccactcttcgctttcgcgtcataa

DBGET integrated database retrieval system