KEGG   Burkholderia mallei ATCC 23344: BMAA0114Help
Entry
BMAA0114          CDS       T00204                                 

Gene name
deoA
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00240  Pyrimidine metabolism
bma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BMAA0114 (deoA)
Enzymes [BR:bma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BMAA0114 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Peptidase_M23
Motif
Other DBs
NCBI-GeneID: 3087341
NCBI-ProteinID: YP_104953
UniProt: Q62EC5
Position
2:110442..111764
Genome map
AA seq 440 aa AA seqDB search
MTFLPQEFIRKVRDRAPLDTADVARFVQGVTAGDVTEGQIAAFAMAVYFNELPLSARIAL
TLAQRDSGDVLDWRGARLNGPVVDKHSTGGVGDLTSLVIGPMVAACGGYVPMISGRGLGH
TGGTLDKLEAIPGYDVAPSVDMLRRVVRDAGLAIVGQTAQLAPADKRIYAVRDVTATVES
ISLITASILSKKLAAGVGALAMDVKVGSGAFMPSAEQSAELARSIVDVGNGAGMRTAATL
TDMNQALAPCAGNAIEVRCAIDFLTGAARPARLEAVSFALAAQMLTMGGLAADAHDARRR
LRAVLESGAAAERFARMVAALGGPADLVERPERHLPRAAAAAPVAAARAGWIERIDARAL
GLAVVGLGGGRAKIGDTLDYSVGLSALAELGERVEAGQPLATVHARDADSAAQATDAVRR
AYRIGAEPPAQTRVVHAVIE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcctgccgcaggaattcatccgcaaggtgcgcgaccgcgcgccgctcgacacg
gccgacgtcgcgcgtttcgtccaaggcgtgacggcgggcgacgtgaccgaaggccagatc
gccgcgttcgcgatggcggtctatttcaacgagttgccgctgtccgcgcgcatcgcgctg
acgctcgcgcagcgcgattccggcgacgtgctcgactggcgcggcgcgcgcctgaacggg
ccggtggtcgacaagcactcgacgggcggcgtcggcgatctgacctcgctcgtgatcggg
ccgatggtggccgcgtgcggcggctacgtgccgatgatctcgggccgcggcctcggccac
acgggcggcacgctcgacaagctcgaggcgattcccggttacgatgtcgcgccgtccgtc
gacatgctgcgccgcgtcgtgcgcgacgcgggccttgcgatcgtcggccagaccgcgcag
ctcgcgcccgccgacaagcggatctatgcggtgcgcgacgtgacggcgaccgtcgaatcg
atctcgctgatcaccgcgtcgatcctgtcgaagaagctcgcggcgggcgtcggcgcgctc
gcgatggacgtgaaggtcggctccggcgcgttcatgccgagcgcggagcaatcggccgaa
ctcgcgcgcagcatcgtcgacgtcggcaacggcgcggggatgaggacggccgcgacgctc
accgacatgaaccaggcgctcgcgccatgcgcgggcaacgcgatcgaggtgcgctgcgcg
atcgatttcctgacgggcgcggcgcgccccgcgcggctcgaagcggtcagcttcgcgctc
gccgcgcagatgctgacgatgggcgggcttgccgcggacgcgcacgatgcgcgccgccgg
ttgcgcgcggtgctcgaatcgggcgcggccgcggagcggttcgcgcggatggtcgcggcg
ctcggcgggcccgccgatctggtcgagcggcccgagcggcatctgccgcgcgcggctgcc
gccgcccccgtggccgccgcgcgcgccggctggatcgagcggatcgacgcgcgcgcgctc
ggcctggcggtcgtcggcctgggcggcgggcgcgcgaagatcggcgacacgctcgattac
tcggtcggactgtccgcgctcgcggagctgggcgagcgcgtcgaggcgggccagccgctc
gcgaccgttcacgcgcgcgacgccgattcggccgcgcaggcgaccgacgcggtgcggcgc
gcctaccggatcggcgcggagccgccggcgcagacgcgcgtcgttcatgccgtgatcgaa
tga

DBGET integrated database retrieval system