KEGG   Burkholderia mallei ATCC 23344: BMAA0399Help
Entry
BMAA0399          CDS       T00204                                 

Definition
(RefSeq) lipoprotein
  KO
K11891  type VI secretion system protein ImpL
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bma00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMAA0399
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bma02044]
    BMAA0399
Secretion system [BR:bma02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMAA0399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C
Motif
Other DBs
NCBI-GeneID: 3087247
NCBI-ProteinID: YP_105195
UniProt: A0A0H2W9S1
Position
2:387061..390690
Genome map
AA seq 1209 aa AA seqDB search
MSHAVARIVRPLPSRDIWTFAGLVVLACFVWLAGPLFAFAEFRPFESGAVRAATIVALFV
AWGARIAWRGWRAGQLNAQLLNQLREAAPRPAATGDPAQAQLDELRSRFDEAATLLKKVR
FGEADGARKGLPRWLEQMSRQYLYQLPWYVFIGAPGSGKTTALVNSGLSFPLAEQFGRAA
IRGVGGTRHCDWWFTNDAVLIDTAGRYTTHESNRALDEAEWKGFVDLLKKYRARQPLNGA
MLTISVADLLGASEAERTQHAMVLRKRLLELRAQLGIRFPVYLLVTKADLLAGFAEYFGG
FGRAECAQVWGFTFPLAESEAPGFELRAAFDREYRLLHQRLNDGLPELLASQTDARQREM
TYLLPQQIADLQDMLGQFVAEVFSVSSFEPMPMLRGVYLTSGTQEGTAFDRVMSGIKRFL
KIEGVPPAAQTGSSGRSFFLKSLLQDHIFREAALAGSNLRWHQRQRVLQIVGYAAIALLC
VAVLFAWLRSYSRNRDYLDEVAARVPAVDAQIGRAKFTGAADIVQLLPVLDELSGLPNAG
GVDLRHPPLAYRWGLFQGEKIEEASDAVYRRALDDVLLPIAASRMEQALRDARPDEVEYA
YAALKAYLMLYDSAHYDPAFVQAVVDLEMERALPADFSSAQRSALRAHLGALFGNRVAVS
PFPMNERLVADVRERLRQVPFSQRLYRQLARTLHASTASYDFSVARAVGPDASLVFRRQS
GKSLADGVPGLYTRSGYRNVFAPRLPGAIDSYGREEVWVLNLGASEIPNPADAAAWARDI
RQLYLNDYIKTWDDYLADIRLQRTSTLAQSIQVARTLSSADSPLTRLMVALARDTPLGDA
PGGARNLASRAQDKVDEARNSLAQIFAGQPGGEAGAAAAPPASPEQIVDSHFAGLRAFAP
GGGDQAASFDAVLKAIDALYTYLTATDDALRSGAAPPPSDAPARLRAQAGRLPTPVREVL
DDLSNVANGSIASVEQRNVAQRAGANVGDFCRQAIAGRYPFARGAARDVAPSDFAQLFAA
GGLMDDFFQKNLQTLVDTTAHPWRFNNRNAEADPSAAAMLGSFEKAAVIRDVYFGGGART
AQIKVEIVPLEMDPSISEMLLDVDGQIVRYAHGPQVPTAVQWPGTRGSNQVRLQVTEQSG
ATGGFTTEGPWALHRLFDRAGVSGGRGPEQMVARFAVDGKPIVLQVTASSVRNPFRLPQM
ESFTCPPKQ
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgctgtcgcacgcatcgttcgcccgctgccgtcgcgggacatctggacgttc
gccggcctcgtcgtgctggcgtgtttcgtttggcttgccgggccgctgttcgcgttcgcc
gagttccgcccgttcgagagcggcgcggtgcgcgcggcgacgatcgtcgcgctgttcgtc
gcgtggggcgcgcggatcgcgtggcgcggctggcgcgcggggcaactgaacgcgcagttg
ctcaaccagttgcgcgaagcggcgccgcggcccgccgcgacgggcgatcccgcgcaggcg
cagctcgacgagctgcgcagccgcttcgacgaagccgcgacgctgttgaagaaagtccgt
ttcggcgaagccgacggcgcgcgcaagggcctgccgcggtggctcgagcagatgtcgcgc
cagtatctgtaccaactgccgtggtacgtgttcatcggcgcgccgggctcgggcaagacg
acggcgctcgtcaactcggggctgagctttccgctcgccgagcagttcgggcgcgcggcg
attcgcggcgtcggcggcacgcggcactgcgactggtggttcacgaacgacgcggtgctg
atcgacaccgcgggccgctacacgacgcacgagagcaaccgcgcgctcgacgaggccgaa
tggaagggcttcgtcgatctgctgaagaagtaccgcgcgcgccagccgctgaacggcgcg
atgctgacgatcagcgtcgccgatctgctcggcgcgtcggaggcggagcgcacgcagcac
gcgatggtgctgcgcaagcgcctgctcgagctgcgcgcgcagctcggcatccgctttccg
gtgtatctgctcgtgacgaaggcggacttgctcgccggcttcgccgaatacttcggcggc
ttcggccgcgccgaatgcgcgcaggtgtggggcttcacgttcccgctcgccgagagcgaa
gcgcccggcttcgagctgcgcgcggcgttcgaccgcgaataccggctgctgcaccagcgg
ctgaacgacgggctgccggagctgctcgcatcgcagaccgacgcgcgccagcgcgagatg
acctacctgctgccgcagcagatcgccgatctgcaggacatgctcggccagttcgtcgcc
gaggtgttctcggtgtcgagcttcgagccgatgccgatgctgcgcggcgtctatctgacg
agcggcacgcaggaaggcaccgcgttcgaccgcgtgatgagcgggatcaagcgcttcctg
aagatcgagggcgtgccgcccgccgcgcagacgggctcgtcgggccgcagtttcttcctg
aaatcgctgctgcaggatcacatctttcgcgaggcggcgcttgccggcagcaatctgcgc
tggcatcagcggcagcgtgtgctgcagatcgtcggctacgcggcgatcgcgctgctgtgc
gtggcggtgctgttcgcgtggctgcgcagctactcgcgcaatcgcgactatctcgacgag
gtcgccgcgcgcgtgccggcggtcgacgcgcagatcggccgcgcgaaattcacgggcgcg
gccgacatcgtgcaactgctgccggtgctcgacgagctgagcggcctgccgaacgcgggc
ggcgtggacttgcggcatccgccgctcgcgtatcgctggggcctgttccagggcgagaag
atcgaggaggcgagcgacgccgtctaccggcgcgcgctcgacgacgtgctgctgccgatc
gccgcgagccggatggagcaggcactgcgcgacgcgcggcccgacgaggtcgagtatgcg
tacgcggcgctcaaggcgtacctgatgctttacgacagcgcgcactacgatcccgcgttc
gtgcaggccgtcgtcgatctcgagatggagcgcgcgctgccggccgatttctcgtccgcg
cagcgcagcgcgctgcgcgcgcatctcggcgcgctgttcggcaatcgcgtcgcggtgtcg
ccgtttccgatgaacgagcggctcgtcgccgacgtgcgcgagcggctgcggcaggtgccg
ttctcgcagcggctgtatcggcagctcgcgcgcacgctgcacgcgagcaccgcgtcgtac
gatttcagcgtcgcgcgcgcggtggggccggacgcgtcgctcgtgttccggcggcagagc
ggcaagagcctcgccgacggcgtgccgggcctctacacgcgcagcggctaccgcaacgtg
ttcgcgccgcgtctgcccggcgcgatcgattcgtacgggcgcgaggaggtgtgggtgctg
aacctcggcgcgtccgagatcccgaatccggccgacgcggccgcctgggcgcgcgacatc
cggcagctctacctgaacgactacatcaagacctgggacgactatctggccgacatccgg
ctgcagcgcacgtcgacgctcgcgcagagcatccaggtcgcgcgcacgctgtcgtcggcc
gattcgccgctcacgcggctgatggtcgcgctcgcgcgcgacacgccgctcggcgatgcg
cccggcggcgcgcgcaatctcgcgtcgcgcgcgcaggacaaggtcgacgaggcgcgcaac
tcgctcgcgcagatcttcgccgggcagccgggcggcgaagcgggcgcggcggccgcgccg
cccgcgagccccgagcagatcgtcgacagccacttcgcggggctgcgcgcgttcgcgccg
ggcggcggggatcaggcggcgtcgttcgacgcggtgctcaaggcgatcgacgcgctgtac
acgtacctcaccgcgaccgacgacgcattgcgcagcggcgcggcgccgccgccgtcggac
gcgcccgcgcggctgcgcgcgcaggcgggccggttgccgacgcctgtgcgcgaggtgctc
gacgatttgtcgaacgtcgcgaacggcagcatcgcgagcgtcgagcagcgcaacgtcgcg
cagcgcgcgggcgcgaacgtcggcgatttctgccggcaggcgatcgccgggcgctacccg
ttcgcgcgcggcgcggcgcgcgacgtcgcgccgtccgatttcgcgcagctgttcgcggcg
ggcggcctgatggacgacttcttccagaagaacctgcaaacgctcgtcgacacgaccgcg
catccatggcgtttcaacaaccgcaacgccgaagccgacccgtcggcggccgcgatgctc
ggctcgttcgagaaggcggcggtgatccgcgacgtctatttcggaggcggcgcgcggacc
gcgcagatcaaggtcgagatcgtgccgctcgaaatggacccgtcgatctcggagatgctg
ctcgacgtcgacggccagatcgtccgctacgcgcacggcccgcaggtgccgacggcggtg
cagtggcccggcacgcgcggcagcaatcaggtgcggctgcaggtgaccgagcagtcgggg
gcgacgggcggcttcacgaccgagggcccgtgggcgctgcaccggctgttcgaccgcgcg
ggcgtgtcgggtgggcgcggacccgagcagatggtcgcgagattcgcggtcgacggcaag
ccgatcgtgctgcaggtgacggcgagcagcgttcgcaacccgttccggttgccgcagatg
gagtcctttacatgtcctccgaagcaatga

DBGET integrated database retrieval system