KEGG   Burkholderia mallei ATCC 23344: BMAA0403
Entry
BMAA0403          CDS       T00204                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bma  Burkholderia mallei ATCC 23344
Brite
KEGG Orthology (KO) [BR:bma00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bma02044]
    BMAA0403
Secretion system [BR:bma02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMAA0403
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AAY59084
UniProt: A0A0H2XD08
Position
2:395605..396183
AA seq 192 aa
MTSKYKASASGQKFIARNRAPRVQIEYDVETYGAERKVQLSFVMGVIADLAGKRAEPLPD
LPERKFLEIDVDNFDERMKSIAPRVAFQVPNTLSGDGMLSVDMTFESIDDFSPAAIARNV
DALRRLLDARTELSNLLSYMDGKHGAEQLIENAINDPALLASLVRQPLAADAEGGARQPV
TGTEDDPEIRHE
NT seq 579 nt   +upstreamnt  +downstreamnt
atgacgagcaagtacaaggcttcggccagcggacagaaattcatcgcgcgcaaccgcgcg
ccgcgcgtgcagatcgagtacgacgtcgagacctacggcgccgagcgcaaggtccaactg
tcgttcgtgatgggcgtgatcgcggatctcgcgggcaagcgggccgagccgctgccggac
ttgccggagcgcaagttcctcgaaatcgacgtcgacaatttcgacgagcggatgaaatcg
atcgcgccgcgcgtcgcgttccaggtgccgaacacgctgtcgggagacggcatgctgagc
gtcgacatgacgttcgagagcatcgacgatttctcgcccgccgcgatcgcgcgcaacgtc
gacgcgttgcggcgcctgctcgacgcgcgcaccgagctgtcgaacctgctgtcgtacatg
gacggcaagcacggcgccgagcaactgatcgaaaacgcgatcaacgatccggcactgctg
gcctcgctcgtgcggcagccgctcgcggcggacgccgaaggcggcgcgcggcagcccgtg
accggcaccgaagacgacccggagattcgccatgaatga

DBGET integrated database retrieval system