KEGG   Burkholderia mallei ATCC 23344: BMAA0405Help
Entry
BMAA0405          CDS       T00204                                 

Definition
(RefSeq) hypothetical protein
  KO
K06887  uncharacterized protein
Organism
bma  Burkholderia mallei ATCC 23344
Brite
KEGG Orthology (KO) [BR:bma00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BMAA0405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-GeneID: 3086832
NCBI-ProteinID: YP_338345
UniProt: A0A0H2XD50
Position
2:397744..398235
Genome map
AA seq 163 aa AA seqDB search
MGVAMFMKVDGVTGESADAQHKGWTDIQSFSWGASQPGAMASGSGGNAGKASFNDLVVAA
YMDKGATAIIKNCASGKHLPTVEISACKTGGSQIEFMRVTLQEVLVTSAQIAGVDPGDAA
DRLMMQYGFQAAKVKKQYWQQNDNGGKGAEVSVGWNIKENTEM
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcgcaatgtttatgaaagtggacggcgtcaccggcgaatcggccgacgcgcag
cacaagggctggaccgacatccagtcgttctcatggggcgcgagccagccgggcgcgatg
gcgagcggcagcggcggcaacgcgggcaaggcgagcttcaacgatctcgtcgtcgccgcg
tacatggacaagggcgcaacggcgatcatcaagaactgcgcgagcggcaagcacctgccg
acggtcgagatatcggcgtgcaagacgggcggctcgcagatcgagttcatgcgcgtgacg
ctgcaggaagtgctcgtcacgtccgcgcagatcgcgggcgtggacccgggcgacgcggcc
gaccggctgatgatgcagtacggttttcaggccgcgaaggtcaagaagcagtactggcag
cagaacgacaacggcggcaagggcgccgaagtgtcggtcggctggaacatcaaggagaac
accgagatgtga

DBGET integrated database retrieval system