KEGG   Burkholderia mallei ATCC 23344: BMAA0442
Entry
BMAA0442          CDS       T00204                                 

Definition
(RefSeq) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
bma  Burkholderia mallei ATCC 23344
Brite
KEGG Orthology (KO) [BR:bma00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bma02044]
    BMAA0442
Secretion system [BR:bma02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMAA0442
SSDB
Motif
Pfam: T6SS_TssF FbpC_C_terminal
Other DBs
NCBI-GeneID: 3087223
NCBI-ProteinID: YP_338354
UniProt: A0A0H2XDL3
Position
2:437267..439129
AA seq 620 aa
MNFLDHYNDELRQLRDAGARFSKEHPQVASALGLHPDAVTDPFVERLLEGVAYLSARVQK
RLDRECAEFAQQALGRICPLYTASTPAISTFAFHPDLGSPDAFRGNTLPRGSLIAAHLPG
RKLPVMFSTAREVTLLPLRLASVECSRSITGLPSLLAQRLASSHAVLRFRFEIEGGASIA
ELAREDDGFKPLHLSVAGDLPRAYALHRALLADTTAWYALVSTNRGDEVLPLPMSGIRLS
GVDDEEALLPEAFGGLPGLRLLREYFAQPTRLLGVYVDALAAIAAKAPSARAFDLFFALR
DAPGDLVGDVDASQFRLFATPAINLYSKRFDPVPYDANQPEQWIPVDRMRPAAHHLWALT
EVFVCETNGRAHRARSVLETAGYEGHEGSIRYGMRREDALLVDGVRRDRFDPLASHDLIA
VSMVDDTLEPDDVATITGRALVADRDWRPSALLDAELQLLDPTAVKRIECLWPASAPRGK
PSIDACWEAVSHVGRNPLALRASQQQDVTARIVEQLLLAIDKDDALDRQRLESLRSVVLR
SRFVAAGRATPTALVRATQVEIDIAESLHADRGGWLFGRLLAQALAEAATLNDGIEIVVR
LDGEAASTHTNVATRDGRLA
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaacttcctcgatcactacaacgacgaattgcgccagttgcgcgatgcgggcgcacgc
ttctccaaggagcacccgcaggtggcctccgcgctcgggctgcatccggatgcggtcacc
gatccgttcgtcgagcgcctgctcgagggcgtcgcgtacctgtcggcgcgcgtgcagaag
cggctcgatcgcgagtgcgcggagttcgcgcagcaggcgctcgggcgcatctgcccgctc
tacacggcttcgacgcccgcgatctcgacgttcgcgttccatcccgatctcggctcgccc
gatgcgtttcgcggcaacacgctgccgcgcggctcgctcatcgccgcgcacctgcccggg
cgcaagctgccggtgatgttctcgaccgcgcgcgaggtcacgctgctgccgctgcgtctc
gcatcggtcgagtgcagccgcagcatcaccgggctgccgtcgctgctcgcgcagcggctc
gcctcgtcgcacgcggtgctgcgcttcaggttcgagatcgagggcggcgcgtcgatcgcg
gagctcgcgcgcgaggacgacggcttcaagccgctgcatctgagcgtggcgggcgatctg
ccgcgcgcatatgcgctgcaccgcgcgctgctcgccgacaccaccgcgtggtacgcgctc
gtgtcgacgaaccgcggtgacgaggtgctgccgttgccgatgtcgggcatccggctgtcc
ggcgtcgacgacgaggaggcgctgctgcccgaggcgttcggcgggctgcccggcctgcgg
ctgctgcgcgagtacttcgcgcagcccacgcggctgctcggcgtctacgtcgacgcgctg
gcggcgatcgccgcgaaggcaccgtccgcgcgcgcgttcgatctgttcttcgcgttgcgc
gacgcgccgggcgatctggtgggcgacgtcgacgcgagccagttccgcctgttcgcgacg
ccggcgatcaatctgtattccaaacgtttcgacccggtgccgtacgacgcgaatcagccc
gagcagtggattcccgtcgaccggatgcggcccgccgcgcatcacctgtgggcgctcacc
gaggtgttcgtgtgcgagaccaacggtcgcgcgcaccgcgcgcgctcggtgctcgagacg
gcgggctacgaagggcacgaaggctcgatccgctacggcatgcggcgcgaggacgcgctg
ctcgtcgacggcgtgcggcgcgaccggttcgatccgctcgcgagccacgacctgatcgcc
gtctcgatggtcgacgacacgctcgagccggacgacgtcgcgacgatcacgggccgcgcg
ctcgtggccgatcgcgactggcgcccgagcgctctgctcgacgccgagctgcaactgctc
gatccgaccgcggtcaagcgcatcgagtgcctgtggccggcgagcgcgccgcgcggcaag
ccgagcatcgacgcgtgctgggaggcggtctcgcacgtcgggcgcaacccgctcgcgctg
cgcgcgtcgcagcagcaggacgtgacggcgcgcatcgtcgagcagttgctgctcgcgatc
gacaaggacgacgcgctcgatcgccagcggctcgagagcctgcgctcggtcgtgctgcgc
tcgcgcttcgtcgcggcggggcgcgccacgcccaccgcgctggtgcgcgcgacacaggtg
gagatcgacatcgccgaatcgctgcacgccgatcgcggcggctggctgttcgggcggctg
ctcgcgcaggcgctcgcggaggccgccacgctcaacgacggcatcgagatcgtggtgcgc
ctggacggcgaagcggcgagcacgcacacgaacgtcgccacgcgagacgggaggctcgca
tga

DBGET integrated database retrieval system