KEGG   Burkholderia mallei ATCC 23344: BMAA0536Help
Entry
BMAA0536          CDS       T00204                                 

Gene name
apaG
Definition
(RefSeq) ApaG protein
  KO
K06195  ApaG protein
Organism
bma  Burkholderia mallei ATCC 23344
Brite
KEGG Orthology (KO) [BR:bma00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BMAA0536 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-GeneID: 3086208
NCBI-ProteinID: YP_105304
UniProt: A0A0H2WDF3
Position
2:545785..546159
Genome map
AA seq 124 aa AA seqDB search
MSQYRFSVSVKTSYLPEQSDPEHRQYAFAYTLTIRNTGQVAAQLIARHWIITDSESQVQE
VKGLGVVGHQPLLQPGEQFEYTSWAVIATPVGTMRGAYFCVAEDGERFEAPVDEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtatcgattcagcgtgtcggtgaagaccagctatttgccggaacaatccgac
cccgaacaccgtcaatacgcattcgcgtacacgctgacgatccgcaatacggggcaggtg
gccgcgcagttgatcgcccggcactggatcatcacggacagcgagagccaggttcaggag
gtgaaggggctcggcgtcgtcggccatcagccgttgctgcagccgggcgagcagttcgag
tacacgagctgggcggtgatcgcgacgccggtgggcacgatgcgcggcgcgtatttttgc
gtcgcggaggacggcgagcgcttcgaggcgcccgtcgacgaattcgcgctgcacatgccg
cgcacgctgcactga

DBGET integrated database retrieval system