KEGG   Burkholderia mallei ATCC 23344: BMAA0544Help
Entry
BMAA0544          CDS       T00204                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00071  Fatty acid degradation
bma00280  Valine, leucine and isoleucine degradation
bma00281  Geraniol degradation
bma00310  Lysine degradation
bma00360  Phenylalanine metabolism
bma00362  Benzoate degradation
bma00380  Tryptophan metabolism
bma00410  beta-Alanine metabolism
bma00627  Aminobenzoate degradation
bma00640  Propanoate metabolism
bma00650  Butanoate metabolism
bma00903  Limonene and pinene degradation
bma00930  Caprolactam degradation
bma01100  Metabolic pathways
bma01110  Biosynthesis of secondary metabolites
bma01120  Microbial metabolism in diverse environments
bma01130  Biosynthesis of antibiotics
bma01212  Fatty acid metabolism
Module
bma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BMAA0544
   00650 Butanoate metabolism
    BMAA0544
  Lipid metabolism
   00071 Fatty acid degradation
    BMAA0544
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMAA0544
   00310 Lysine degradation
    BMAA0544
   00360 Phenylalanine metabolism
    BMAA0544
   00380 Tryptophan metabolism
    BMAA0544
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMAA0544
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BMAA0544
   00281 Geraniol degradation
    BMAA0544
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMAA0544
   00627 Aminobenzoate degradation
    BMAA0544
   00930 Caprolactam degradation
    BMAA0544
Enzymes [BR:bma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BMAA0544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 3085995
NCBI-ProteinID: YP_105312
UniProt: A0A0H2WDX8
Position
2:553620..554396
Genome map
AA seq 258 aa AA seqDB search
MAYENILVETRGRVGLITLNRPKALNALNDALMDELGLALKAFDADEGIGAIVLTGSEKA
FAAGADIGMMATYSYMDVFKGDYITRNWETVRQIRKPIIAAVAGFALGGGCELAMMCDII
FAADTAKFGQPEIKLGVLPGAGGTQRLPRAVSKAKAMDMCLTARFMDAEEAERAGLVSRI
LPADKLLDEAIAAATTIAEFSLPAVMMVKEAVNRAYETTLSEGVHFERRLFHSAFATEDQ
KEGMAAFVEKRKPVFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgagaacattctggtggagacgcggggcagggtggggctgattacgctgaac
cgtccgaaggcgctgaatgcgttgaatgacgccctgatggatgaacttggcttggcgctc
aaagcgttcgacgcggacgagggtattggcgcgatcgtgctgacgggcagcgagaaggcg
ttcgcggcgggcgccgacatcgggatgatggcgacctattcatacatggacgtcttcaag
ggcgactacatcacgcgtaactgggagacggtgcgccagatccgcaagccgatcatcgcg
gcggtggcgggtttcgcgctgggcggcggctgcgaactcgcgatgatgtgcgacatcatc
tttgcggccgatacggcgaagttcggccagccggaaatcaagctcggcgtgctgccgggt
gcgggcggcacgcagcgcctgccgcgcgcggtgtcgaaggcgaaagcgatggacatgtgc
ttgaccgcgcgcttcatggacgcggaggaggctgagcgggcgggcttggtgtcgaggatc
ctgccggcggacaagttgctcgacgaggcgatcgccgcggcgacgacgatcgcggaattc
tcgctgcctgccgtaatgatggtgaaggaggcggtgaatcgcgcatacgagacgaccttg
tccgaaggggtgcacttcgagcgtcgcttgtttcactcggcatttgcgactgaagatcag
aaggaagggatggcggcgttcgtcgagaagcgcaagcccgtcttcaagcatcgctga

DBGET integrated database retrieval system