KEGG   Burkholderia mallei ATCC 23344: BMAA0744
Entry
BMAA0744          CDS       T00204                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bma  Burkholderia mallei ATCC 23344
Brite
KEGG Orthology (KO) [BR:bma00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bma02044]
    BMAA0744
Secretion system [BR:bma02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMAA0744
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AAY59319
UniProt: A0A0H2XF68
Position
2:complement(762178..762672)
AA seq 164 aa
MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAADKPPLEELSPVNVDKD
DFNDVMRAQNLQLALSVPNLLDDQAGEDDRLSVTLGFDSVHDFSPDAIVEKVPELKQLIA
LRDALKALKSPIGNIPGFRRRIQEIVADKGARKQLLDELGLDEQ
NT seq 495 nt   +upstreamnt  +downstreamnt
atgacaacgaacggatccgtcgcacccaaagagcgggtcaacatcgtctatcgcccggcg
acgggcgacgcgcaggcggaggtcgagctgccgctcaaggtgctcgtgctcggcgagttc
tcgacggccgccgacaagccgccgctcgaggagctctcgcccgtgaacgtcgacaaggac
gacttcaacgacgtgatgagggcgcagaacctccagctcgcgctcagcgtgccgaacctg
ctggacgatcaggccggcgaggacgaccggctgtccgtcacgctcggcttcgattcggtg
cacgatttctcgcccgacgcgatcgtcgagaaagtgcccgagctcaagcagctgatcgcg
ctgcgcgacgcgctgaaagcgctgaagagcccgatcggcaacattcccggctttcgcagg
cgcatccaggagatcgtcgccgacaagggcgcgcgcaagcagttgctcgacgaactcggc
ctcgacgaacaatga

DBGET integrated database retrieval system