KEGG   Burkholderia mallei ATCC 23344: BMAA1794Help
Entry
BMAA1794          CDS       T00204                                 

Gene name
acs
Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00010  Glycolysis / Gluconeogenesis
bma00620  Pyruvate metabolism
bma00640  Propanoate metabolism
bma00680  Methane metabolism
bma01100  Metabolic pathways
bma01110  Biosynthesis of secondary metabolites
bma01120  Microbial metabolism in diverse environments
bma01130  Biosynthesis of antibiotics
bma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMAA1794 (acs)
   00620 Pyruvate metabolism
    BMAA1794 (acs)
   00640 Propanoate metabolism
    BMAA1794 (acs)
  Energy metabolism
   00680 Methane metabolism
    BMAA1794 (acs)
Enzymes [BR:bma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BMAA1794 (acs)
Lipid biosynthesis proteins [BR:bma01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BMAA1794 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 3087408
NCBI-ProteinID: YP_106348
UniProt: Q62AD1
Position
2:complement(1961948..1963930)
Genome map
AA seq 660 aa AA seqDB search
MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAERDYEGFWARLARETLEWRKP
FGKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGLGERVAVIFEADDGTVTRVTYADLL
ARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQACARIGATHSVVFGGFSSKSLHER
IVDVGATALVTADEQMRGGKTLPLKSIADEALAMGGCDAVKTVVVYRRTGGNVDWHAGRD
VWMHEMVANESDACEPEWVGAEHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFD
WKPDDVFWCTADIGWVTGHSYITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVTVF
YTAPTAIRSLIKAAEADDRVHPRSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQARCPIV
DTWWQTETGGHMITPLPGATPTVPGSCTLPLPGIMAAVVDETGQDVPNGQGGILVVKRPW
PAMARTIWGDPERFKKSYFPEELGGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRL
GTMEIESALVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEGEEAAALAKTLRDWVG
KEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILEQLAEVR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgattgaatcggttctgcacgaacgccgccagttcgcgccgcccgccgccgtg
gagaaggcggcagccatttccgggatggcggcttatcgggcgctcgccgaagaggctgag
cgcgattacgaaggattctgggcgcgtctcgcgcgcgagacgctcgaatggcgcaagccg
ttcggcaaggtgctcgacgagacgaacgcgccgttctacaagtggttcgaggacggcgag
ctgaacgcgtcgtacaactgcctcgaccgccacgtcgccgcgggcttgggcgagcgcgtc
gcggtgatcttcgaggccgacgacggcaccgtcacgcgcgtcacctacgccgatctgctc
gcgcgcgtgtcgcgcttcgcgaacgcgctgaagaagcgcggcgtcggccgcggcgaccgc
gtcgtcatctacattccgatgtcggtcgaaggcatcgtcgcgatgcaggcgtgcgcgcgg
atcggcgcgacgcactcggtggtgttcggcggcttctcgtcgaagtcgctgcacgagcgc
atcgtcgacgtcggcgcgaccgcgctcgtcaccgccgacgagcagatgcgcggcggcaag
acgctgccgctcaagagcatcgccgacgaggcgctcgcgatgggcggctgcgacgcggtg
aagaccgtcgtcgtgtatcgccgcacgggcggcaatgtcgactggcacgcgggccgcgac
gtctggatgcacgagatggtcgcgaacgagtccgacgcgtgcgagcccgaatgggtcggc
gccgagcatccgctgttcatcctgtacacgtccggctcgaccggcaagccgaagggcgtc
cagcacagcacggccggctatctgctatgggtcgcgcagacgatgaagtggacgttcgac
tggaagcccgacgacgtgttctggtgcacggccgacatcggctgggtcacgggccactcg
tatatcacgtatgggccgctcgccgtcggcgcgacgcaggtggtgttcgagggcgtgccg
acctatccgaacgcgggccgcttctggaagatgatcggcgaccacaaggtcaccgtgttc
tacaccgcgccgaccgcgatccgctcgctgatcaaggcggccgaggccgacgaccgcgtg
catccgaggagctacgatctgtcgagcctgcggatcatcggcacggtcggcgagccgatc
aatccggaagcgtggatctggtatcacaagaacgtcgggcaggcgcgctgcccgatcgtc
gacacctggtggcagaccgaaacgggcggccacatgatcacgccgctaccgggcgcgacg
ccgacggtgccgggctcgtgcacgctgccgctgccgggcatcatggccgcggtcgtcgac
gagacgggccaggacgtgccgaacgggcagggcggcattctcgtcgtcaagcgcccgtgg
ccggcgatggcgcgcacgatctggggcgacccggagcgcttcaagaagagctatttcccc
gaggagctcggcggccgcctgtatctggcgggcgacggcaccgtgcgggacaaggaaacc
ggctacttcacgatcatgggccgcatcgacgacgtgctgaacgtatcggggcaccggctc
ggcacgatggagatcgaatcggcgctcgtgtcgcacgagctcgtcgccgaggcggccgtc
gtcggacggccggacgacacgacgggcgaggcggtcgtcgcgttcgtcgtgctcaagcgc
tcgcggccggaaggcgaggaggcggccgcgctcgcgaagacgctgcgcgactgggtcggc
aaggagatcgggccgatcgcgaagccgaaggacatccgtttcggcgataacctgccgaag
acgcgttcgggcaagatcatgcggcgcctgctgcgctcgctcgcgaagggcgaggcgatc
acgcaggatacgtcgacgctcgagaaccccgcgattctcgaacagctcgccgaagtgcgc
tga

DBGET integrated database retrieval system