KEGG   Burkholderia mallei ATCC 23344: BMAA1910Help
Entry
BMAA1910          CDS       T00204                                 

Definition
(RefSeq) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
bma  Burkholderia mallei ATCC 23344
Brite
KEGG Orthology (KO) [BR:bma00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bma02044]
    BMAA1910
Secretion system [BR:bma02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMAA1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-GeneID: 3087760
NCBI-ProteinID: YP_338535
UniProt: A0A0H2XD31
Position
2:2094010..2095509
Genome map
AA seq 499 aa AA seqDB search
MKKQQAQTAAAGVQPQADSDFAQLLAQEFKPKTEQAREAVEYAVRTLAEQALAQSATISD
DAYKSIAAIIAQIDHKLSEQINLILHHADFQKLESAWRGLHHLVSNTETDERLKIRFMDI
SKEELRRTMRRYKGQSWDQSPLFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLGS
ISKVAASAHTPFLSGASPSVLQMESWQELANPRDLTKIFTQNLEYASWNALRNMDDARYI
GLAMPRFLSRLPYGVLTNPVDEFDFEEDTNGADHRRYAWTNAAYAMGVNINRSFRLYGWC
SLIRGVESGGTVENLPCHTFPTDDGGIDIKCPTEIAISDRREAELSKNGFIPLVHRKNTD
HATFIGAQSLHKPAEYDDSDATANANLSARLPYLFACSRFAHYLKCIVRDKVGAFKERED
MQRWLNEWIMNYVDADPANSSQDTKARRPLAAAEVVVEQAQGNPGYYQAKFFLRPHFQLE
GLTVSLRLVAKLPSIKEAA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacagcaagcccagacggccgccgccggcgtccagccgcaagcggattcggat
ttcgcgcagttgctcgcgcaggagttcaagccgaagacggagcaggcgcgcgaagcggtc
gaatacgcggtgcgcacgctcgccgagcaggcgctcgcgcaatcggcgacgatcagcgac
gatgcatacaagagcatcgccgcgatcatcgcgcagatcgaccataagctatccgaacag
atcaacctgatcctccatcacgcggatttccagaagctcgaatcggcgtggcgcgggctg
catcacctggtgtcgaacaccgagaccgacgagcgcctgaagatccgcttcatggacatc
tcgaaggaagagctgcgccgcacgatgcggcgctacaaggggcaatcgtgggaccagagc
ccgctcttcaagcagatctacgaggaggagtacgggcagctcggcggcgagccgtacggc
tgcctcgtcgccgattactacttcgaccacacgccgcccgacgtcgacctgctcggctcg
atctcgaaggtggccgcgtccgcgcacacgccgttcctctccggcgcgtcgccttcggtg
ctgcagatggaatcgtggcaggagctcgcgaacccgcgcgacctgacgaagatcttcacg
caaaacctcgaatacgcgtcatggaacgcgctgcgcaacatggacgacgcgcgctacatc
ggcctcgcgatgccgcgcttcctgtcgcgcctgccgtacggcgtgctgacgaatcccgtc
gacgagttcgacttcgaggaagacacgaacggcgccgaccatcgccgctatgcgtggacg
aacgccgcctacgcgatgggcgtgaacatcaaccggtcgttccggctctacggctggtgc
tcgctcattcgcggcgtcgaatcgggcggcacggtcgagaacctgccgtgccatacgttc
ccgaccgacgacggcggcatcgacatcaaatgcccaaccgagatcgcgatctcggaccgg
cgcgaggcggagctgtcgaagaacggcttcattccgctcgtgcaccgcaagaacaccgat
cacgcgacgttcatcggcgcgcaatcgctgcacaagccggccgaatacgacgattccgac
gcgacggccaacgcgaacctgtcggcgcgcctgccgtatctgttcgcatgctcgcgcttc
gcgcactacctgaagtgcatcgtgcgcgacaaggtgggcgccttcaaggagcgcgaggac
atgcagcgctggctgaacgaatggatcatgaactacgtcgacgcggacccggcgaactcg
tcgcaggacacgaaggcgcgccggccgctcgcggccgccgaggtggtcgtcgagcaggcg
cagggcaaccccggctactaccaggcgaagttcttcctgcggccgcatttccagctcgag
ggcctgaccgtgtcgctgcggctcgtcgcgaagctgccgtcgatcaaggaagccgcctga

DBGET integrated database retrieval system