KEGG   Burkholderia mallei 2002734299: BM45_3155
Entry
BM45_3155         CDS       T03872                                 

Definition
(GenBank) type IV/VI secretion system, DotU family domain protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bmab  Burkholderia mallei 2002734299
Pathway
bmab03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BM45_3155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmab02044]
    BM45_3155
Secretion system [BR:bmab02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BM45_3155
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AJX04852
UniProt: A5PM28
Position
2:complement(34297..34962)
AA seq 221 aa
MKLTDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDHAACAGAPAADVDDALFAV
CAWIDEALLNSGWDDADRWTLRLLQKRYFDTSHAGVVFFERLGTLDGARASVLEVYLLCL
RLGFRGRYGYDGGDGPLDAIRQRALDALSAHAPPCAAGEPPFPAAYAHAGPHAAAAKART
RRRIARAGLSVGLPLAILLSLYLIYHVVIVRMVDAVYPRLQ
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaagctgaccgattcgatgatgccgctcgtcgcgtatgcgcggcagctcgcgcaatcg
ccgcgcggcgacgccgccgaagtcgcgctgcggctcgacatcctgatcgagcgcgcgcgc
gaccacgcggcgtgcgcgggcgcacccgcggccgacgtcgacgacgcgctgttcgcggtg
tgcgcgtggatcgacgaggcgctgctgaacagcggctgggacgatgccgatcgctggacg
ctgcggctgctgcaaaagcgctacttcgatacgtcgcacgcgggcgtcgtgttcttcgaa
cgcctcggcacgctcgacggcgcgcgcgcgagcgtgctcgaggtctacctgctgtgcctg
cggctcggctttcgcggccgctacggctacgacggcggcgacggcccgctcgacgcgatc
cgccagcgcgcgctcgatgcactgtcggcgcacgcgccgccgtgcgccgcgggcgagccg
ccgtttcccgccgcctatgcgcacgccggcccgcacgccgccgccgcgaaagcgcgcacg
cgccgccggatcgcgcgcgcggggctgagcgtcgggctgccgctcgccatcctgctgtcg
ctctatctgatctatcacgtcgtcatcgtgcggatggtcgacgcggtgtaccccaggctg
caatga

DBGET integrated database retrieval system