KEGG   Burkholderia mallei 2002734299: BM45_4257Help
Entry
BM45_4257         CDS       T03872                                 

Definition
(GenBank) mannose-6-phosphate isomerase family protein
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
bmab  Burkholderia mallei 2002734299
Pathway
bmab00051  Fructose and mannose metabolism
bmab00520  Amino sugar and nucleotide sugar metabolism
bmab01100  Metabolic pathways
bmab01110  Biosynthesis of secondary metabolites
bmab01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BM45_4257
   00520 Amino sugar and nucleotide sugar metabolism
    BM45_4257
Enzymes [BR:bmab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BM45_4257
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     BM45_4257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer Cupin_2 AraC_binding Cupin_1
Motif
Other DBs
NCBI-ProteinID: AJX04152
Position
2:1396418..1396696
Genome map
AA seq 92 aa AA seqDB search
MKRIVVKPGARLSLQMHHHRAEHWIVVRGTARITRGDETFLLSENESTYIPLGVSHRLEN
PGKMPLELIEVQSGAYLGEDDIVRFEDNYGRH
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcggatcgtcgtcaagccgggcgcacgcctgtcgctgcagatgcatcaccatcgc
gcggagcattggatcgtcgtgcgcggcaccgcgcgcatcacacgcggcgacgaaacgttt
ttgctctccgagaacgaatcgacctacattccgctcggcgtgtcgcatcggctcgagaat
cccggcaagatgccgctcgaactgatcgaggtgcaatcgggcgcgtatctcggggaagac
gacatcgtccgcttcgaagacaactatggacgacattga

DBGET integrated database retrieval system