KEGG   Burkholderia mallei 2002734299: BM45_4684Help
Entry
BM45_4684         CDS       T03872                                 

Definition
(GenBank) beta-eliminating lyase family protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bmab  Burkholderia mallei 2002734299
Pathway
bmab00260  Glycine, serine and threonine metabolism
bmab01100  Metabolic pathways
bmab01110  Biosynthesis of secondary metabolites
bmab01120  Microbial metabolism in diverse environments
bmab01130  Biosynthesis of antibiotics
bmab01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BM45_4684
Enzymes [BR:bmab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BM45_4684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJX04671
UniProt: A0A3N4FTH5
Position
2:1916180..1917193
Genome map
AA seq 337 aa AA seqDB search
MIDLRSDTVTRPSAPMLAAMTAAEVGDDVWGDDPTVARLQAVVAEHAGKEAALFFPSGTQ
SNLAALMSHCERGDEYIVGQAAHTYKYEGGGAAVLGSIQPQPIENAADGTLPLEKIAAAI
KPIDDHFARSRLFTLENTIGGKVLPAGYVDEAVALARSRGLAAHLDGARVCNAAVASGRA
IAELCAPFDSVSICFSKGLGAPVGSVLVGSGALIERAHRWRKVLGGGMRQAGVLAAACLY
ALEHNVERLADDHANAERLAQGLARIEPVKVLSQATNMVFAQFPEADCAPLEAWLKERGI
LTQMLYASRFVTHCDVSRDDIDTAVAAISAYFARSRA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgcagcgataccgtgacgcgcccgagcgcgccgatgctggccgcgatg
acggccgccgaagtgggcgacgacgtgtggggcgacgatcccaccgtcgcgcgcctgcag
gccgtggtggccgagcacgcgggcaaggaggcggcgctgttctttccgagcggcacgcag
agcaacctcgcggcgctgatgtcgcactgcgagcgcggcgacgagtacatcgtcggccag
gccgcgcacacgtacaaatacgagggcggcggcgcggcggtgctcggcagcattcagccg
cagccgatcgagaacgccgcggacggcacgctgccgctcgagaagatcgcggccgcgatc
aagccgatcgacgatcacttcgcccgctcgcgcctgttcacgcttgagaacacgatcggc
ggcaaggtgctgccggcgggctatgtcgacgaagcggtcgcgctcgcgcgcagccgcggg
ctcgctgcgcatctcgacggcgcgcgcgtatgcaacgcggccgtcgcgtcgggccgcgcg
atcgccgagctgtgcgcgccgttcgattcggtgtcgatctgcttttcgaaggggctcggc
gcgccggtgggctcggtgctcgtcggcagcggcgcgctgatcgagcgcgcgcaccgctgg
cgcaaggtgctcggcggcggcatgcgccaggcgggcgtgctcgcggccgcgtgcctgtat
gcgctcgagcacaacgtcgagcgtctcgccgacgatcacgcgaacgccgagcgcctcgcg
cagggcctcgcgcgcatcgagccggtgaaggtgctgtcgcaggcgacgaacatggtgttc
gcgcaatttcccgaagccgattgcgcgccgctcgaagcatggctcaaggagcgcgggatt
ctcacgcagatgctgtatgcgtcgcgcttcgtcacgcactgcgacgtgtcgcgcgacgac
atcgacacggctgtcgccgcgatcagcgcgtatttcgcgcgttcgcgcgcttga

DBGET integrated database retrieval system