KEGG   Burkholderia mallei 2002734299: BM45_4807Help
Entry
BM45_4807         CDS       T03872                                 

Definition
(GenBank) peptidase M20/M25/M40 family protein
  KO
K05994  bacterial leucyl aminopeptidase [EC:3.4.11.10]
Organism
bmab  Burkholderia mallei 2002734299
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bmab01002]
    BM45_4807
Enzymes [BR:bmab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.10  bacterial leucyl aminopeptidase
     BM45_4807
Peptidases [BR:bmab01002]
 Metallo Peptidases
  Family M28: aminopeptidase Y family
   BM45_4807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 Peptidase_M20 Peptidase_M42 DUF2499
Motif
Other DBs
NCBI-ProteinID: AJX04214
UniProt: A0A3N4FMR3
Position
2:complement(2062030..2063256)
Genome map
AA seq 408 aa AA seqDB search
MSKLQHLAAAVCGALCVSAAHAAPVWITLSEPALHELRALDPAVTSRYSAALATGDAKRT
ETIHVAQVDDSLLESLSQAIRRARGHGPGFFVHATFDEARASLQPSAAKQAAAIDYPITY
SQQVRNWISQLQASNIVSTIVSLSGFTNRYYTTTHGVAASDWIAQQWKQLAGSRTDVTVE
QFTHAGWPQKSVILTIKGSDPAAGVVVIGGHLDSTVGRMSENTRAPGADDDASGIASLTE
ALRVLLANRYQPKRTLKFIGYAAEEAGLLGSQAIAKQFRAQNVNVVGAFQLDMTNYKGDP
KDIYLISDYTNATQNTYLANLAKAYLPELAVGTSQCGYACSDHASWNAQGYPASFPFEAD
QNDNPYIHSAYDTLERSDSQGNHALKFSKLALAYAAELGGGLSASAKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagctccaacacctcgccgccgcggtctgcggcgccctctgcgtatcggcggcc
catgccgcgccggtgtggatcacgctctccgagcccgccctgcacgagctgcgcgcgctc
gatcccgccgtgacgagccgttacagcgcggcgctcgccaccggcgacgcgaagcgcacc
gaaacgatccacgtcgcgcaggtcgacgattcgctgctcgaatcgctgtcgcaggcgatc
cgccgcgcgcgcggccacggcccgggctttttcgtgcacgcgacgttcgacgaagcgcgc
gcgtcgctgcagccgagcgcggcgaagcaggcggccgcgatcgattacccgatcacctac
tcgcaacaggtccgcaactggatctcgcaactgcaggcgagcaacatcgtcagcaccatc
gtctcgctgtccggcttcacgaaccgctactacacgacgacgcacggcgtggccgcgtcc
gactggatcgcgcagcaatggaagcagttggccggctcgcgcaccgatgtgacggtcgag
cagttcacgcatgccggctggccgcagaaatcggtgatcctgacgatcaagggcagcgat
ccggccgcgggcgtcgtcgtgatcggcggccatctcgattcgaccgtcggccgcatgagc
gagaacacgcgcgcgcccggcgcggacgatgacgcatccggcatcgcaagcctcaccgag
gcgctgcgcgtgctgctcgcgaaccgctaccagccgaagcgcacgctcaagttcatcggc
tacgcggcggaagaggcgggccttctcggctcgcaggcgatcgcgaagcagttcagggcg
cagaacgtgaacgtcgtcggcgcgttccagctcgacatgacgaactacaagggagatccg
aaggatatctatctgatcagcgactacacgaacgcgacacagaacacgtacctcgcgaac
ctcgcgaaagcgtatctgcccgagctcgcggtcggcacgtcgcaatgcggctatgcgtgc
tccgatcacgcgtcgtggaacgcgcagggctatccggcgtcgttcccgttcgaagcggat
cagaacgacaatccgtacatccattccgcgtatgacacgctcgagcggtcggactcgcaa
ggcaaccacgcgctgaagttcagcaagctcgcgctcgcgtacgcggcggagctgggcggc
gggctgagcgcgtccgcgaagcggtaa

DBGET integrated database retrieval system