KEGG   Burkholderia mallei 2002734299: BM45_498Help
Entry
BM45_498          CDS       T03872                                 

Definition
(GenBank) alpha/beta hydrolase fold family protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
bmab  Burkholderia mallei 2002734299
Pathway
bmab00903  Limonene and pinene degradation
bmab00930  Caprolactam degradation
bmab01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BM45_498
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BM45_498
Enzymes [BR:bmab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     BM45_498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: AJX03127
UniProt: A0A3N4FXP0
Position
1:513548..514513
Genome map
AA seq 321 aa AA seqDB search
MSWQSKVACWLLRRQFRPETLRPVIDPARARRLTKLRVRVPRRAPAGWRLRERYGPAAAP
LRGEWLERADVAPGRAQRGRMLLYFHGGGYYFCSPQTHRPLVFALTKLAGVRSFSLDYRL
APEHPFPAALDDALAAYRQLVSAGTPPESIVFGGDSAGGGLALATLVALRDAGDPLPSGA
VLFSPWTDLAATGDTLRTHDGLDPMFAGAALGRAARLYLGDTPGTHPHASPLYADFAGLP
PLFIQAGSTEVLLDDSRRVAEKARAAGVHVELEIWPQMPHVWQIFVPFVPESARALERAA
AFVRRTAVERATQRTADASIA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcagagcaaggtggcgtgctggctgctgcgccggcagtttcgtccggagacg
ctgcgcccggtgatcgatccggcgcgcgcgcggcggctcacgaagctgcgggtgcgcgtg
ccgcgccgtgcgcccgccggctggcggttgcgcgagcgctacggcccggcggccgcgccg
ctgcgcggcgagtggctcgaacgcgcggacgtcgcgcctgggcgcgcgcagcgcggccgg
atgctgctgtatttccacggcggcggctattacttctgttcgccgcagacgcaccgcccg
ctcgtgttcgcgctgacgaagctcgccggcgtgcgctcgttctcgctcgactatcggctc
gcgcccgagcatccgtttccggccgcgctcgacgatgcgctcgccgcgtaccggcagctc
gtgtccgccggcacgccgccggagtcgatcgtgttcggcggcgattcggcgggcggcggc
ctcgcgctcgcgacgctcgtcgcgctgcgcgacgcgggcgatccgctgccgtcgggcgcg
gtgctgttctcgccgtggaccgatctcgccgcgacgggcgatacgctgcgcacgcacgac
gggctcgatccgatgttcgcgggcgcggcgctcggccgcgcggcgcgcctttatctcggc
gacacgccgggcacgcatccgcatgcgtcgccgctctacgcggatttcgcgggattgccg
ccgctcttcattcaggcgggcagcaccgaggtgctgctcgacgattcgcggcgcgtcgcc
gagaaggcgcgcgcggcgggcgtgcacgtcgagctggagatatggccgcagatgccgcac
gtctggcagatctttgtgccgttcgtgcccgaatcggcgcgtgcgctcgagcgcgcggcc
gcgttcgtgcggcgcaccgcggtcgagcgcgcgactcagcgcacggccgacgcgtcgatc
gcctga

DBGET integrated database retrieval system