KEGG   Burkholderia mallei 2002734299: BM45_785Help
Entry
BM45_785          CDS       T03872                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bmab  Burkholderia mallei 2002734299
Pathway
bmab00030  Pentose phosphate pathway
bmab00480  Glutathione metabolism
bmab01100  Metabolic pathways
bmab01110  Biosynthesis of secondary metabolites
bmab01120  Microbial metabolism in diverse environments
bmab01130  Biosynthesis of antibiotics
bmab01200  Carbon metabolism
Module
bmab_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bmab_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
bmab_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BM45_785 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BM45_785 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmab04147]
    BM45_785 (zwf)
Enzymes [BR:bmab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BM45_785 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BM45_785 (zwf)
Exosome [BR:bmab04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BM45_785 (zwf)
  Exosomal proteins of colorectal cancer cells
   BM45_785 (zwf)
  Exosomal proteins of bladder cancer cells
   BM45_785 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AJX01875
Position
1:complement(833003..834472)
Genome map
AA seq 489 aa AA seqDB search
MHTDSSFTFVLFGGTGDLSMRKILPALFEAHRANMLSEAGRIVAVARHAADREGYLQWVE
EHVKPHAAKAAGGAFDEAVWRSFLERIVYVKLDLGRAEDYALLRDTVGGLSGIRVFYLAT
GPSLFVPICKALAAVGLNEGARIVLEKPLGYDLRSSNAINDAVGEIFAEDQIYRIDHYLG
KEPVQNLLALRFGNALFEPLWRREWVESIQITIAEELGVEARGDFYDNTGALRDMVQNHL
LQLLSIVAMEPPHSMDSDSVRDEKLRVLRALKPVDPRDIGKVAVRGQYHVGVIKGAQVPA
YATEPGVKADSQTETFVALKVEIENWRWAGVPFFLRTGKRLADRVAEIVVNFRPVPHSAL
GPTALRAGANRLVIRLQPNESIRLYCLAKQPGEGMNLASVHLDLAFDQFFKEGQMEAYQR
LLLDVINGRLALFVRRDEQEAAWRWVEPILNEWARTTKPPKPYAAGTWGPAAASAMLAQH
GTCWLEEEN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcataccgattcgagcttcaccttcgttctcttcggcggcaccggcgatctgtcgatg
cgcaagatcctccccgcgctcttcgaagcgcatcgcgcgaacatgctgtcggaagccggc
aggatcgtcgccgtggcccgccacgcggcggaccgcgaaggctacctgcagtgggtcgag
gagcacgtgaagccgcacgcggcgaaggcggcgggcggcgcgttcgacgaagcggtctgg
cggagctttctcgagcgcatcgtctacgtgaagctcgacctcggccgcgcggaagattac
gcgctgctgcgcgacacggtcggcgggctctcgggcatccgcgtgttctacctggcgacg
ggcccgtcgctgttcgtgccgatctgcaaggcgctcgccgcggtgggcctgaacgaaggc
gcgcgcatcgtgctcgagaagccgctcggctacgacctgcgctcgtcgaacgcgatcaac
gacgcggtgggcgagatcttcgccgaagaccagatctaccggatcgatcactacctcggc
aaggagccggtgcagaacctgctcgcgctgcgcttcggcaacgcgctcttcgagccgctg
tggcgccgcgaatgggtggagagcatccagatcacgatcgccgaggagctcggcgtcgag
gcgcgcggcgatttctacgacaataccggcgcgctgcgcgacatggtgcagaaccacctg
ctgcagctgctgtcgatcgtcgcgatggagccgccgcactcgatggattccgattcggtg
cgcgacgagaagctgcgcgtgctgcgcgcgttgaagcccgtcgatccgcgcgacatcggc
aaggtcgcggtgcgcggccagtaccacgtgggcgtgatcaagggcgcgcaggtgcccgcg
tacgcgaccgagcccggcgtgaaggcggacagccagaccgagacgttcgtcgcgctgaag
gtcgagatcgagaactggcgctgggccggcgtgccgttcttcctgcgcaccggcaagcgc
ctcgccgaccgcgtcgcggagatcgtcgtcaacttccggccggtgccgcactcggcgctc
ggccccaccgcgctgcgcgcgggcgcgaaccgtctcgtgatccggctgcagccgaacgaa
tcgatccgcctgtactgcctcgcgaagcagccgggcgaagggatgaacctggcgagcgtg
cacctcgacctcgcgttcgaccagttcttcaaggaaggccagatggaggcgtaccagcgc
ctgctgctcgacgtgatcaacggccgcctcgcgctcttcgtccggcgcgacgagcaggaa
gccgcatggcgctgggtcgagccgatcctgaacgaatgggcgcgcacgacgaagccgccg
aagccgtacgcggccggcacctggggcccggccgcggcgagcgcgatgctcgcgcagcac
ggcacctgctggctcgaagaagaaaactga

DBGET integrated database retrieval system